Shopping Cart
- Remove All
- Your shopping cart is currently empty
Theraphotoxin-Tap1a (Tap1a) is a spider venom-derived peptide that acts as an inhibitor of sodium channels, displaying IC50 values of 80 nM for Na v 1.7 and 301 nM for Na v 1.1. It demonstrates analgesic effects [1].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | Theraphotoxin-Tap1a (Tap1a) is a spider venom-derived peptide that acts as an inhibitor of sodium channels, displaying IC50 values of 80 nM for Na v 1.7 and 301 nM for Na v 1.1. It demonstrates analgesic effects [1]. |
Alias | TRTX-Tap1a, Theraphotoxin-Tap1a, µ/ω-TRTX-Tap1a |
Molecular Weight | 4182.68 |
Formula | C174H258N52O55S7 |
Sequence | Asp-Asp-Cys-Leu-Gly-Met-Phe-Ser-Ser-Cys-Asp-Pro-Asn-Asn-Asp-Lys-Cys-Cys-Pro-Asn-Arg-Lys-Cys-Ser-Arg-Lys-Asp-Gln-Trp-Cys-Lys-Tyr-Gln-Leu-Trp (Disulfide bridge:Cys3-Cys18, Cys10-Cys23, Cys17-Cys30) |
Sequence Short | DDCLGMFSSCDPNNDKCCPNRKCSRKDQWCKYQLW (Disulfide bridge:Cys3-Cys18, Cys10-Cys23, Cys17-Cys30) |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.