Shopping Cart
- Remove All
- Your shopping cart is currently empty
Tamapin TFA, a venom peptide isolated from the Indian red scorpion (Mesobuthus tamulus) [1], selectively targets and blocks small conductance Ca(2+)-activated K(+) (SK) channels, particularly the SK2 subtype (Potassium Channel). It is known to inhibit SK channel-mediated currents in the hippocampal pyramidal neurons.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | Tamapin TFA, a venom peptide isolated from the Indian red scorpion (Mesobuthus tamulus) [1], selectively targets and blocks small conductance Ca(2+)-activated K(+) (SK) channels, particularly the SK2 subtype (Potassium Channel). It is known to inhibit SK channel-mediated currents in the hippocampal pyramidal neurons. |
Molecular Weight | 3458.11 (free base) |
Formula | C146H238N44O41S6.xC2HF3O2 |
Sequence | Ala-Phe-Cys-Asn-Leu-Arg-Arg-Cys-Glu-Leu-Ser-Cys-Arg-Ser-Leu-Gly-Leu-Leu-Gly-Lys-Cys-Ile-Gly-Glu-Glu-Cys-Lys-Cys-Val-Pro-Tyr-NH2 (Disulfide bridge: Cys3-Cys21, Cys8-Cys26, Cys12-Cys28) |
Sequence Short | AFCNLRRCELSCRSLGLLGKCIGEECKCVPY-NH2 (Disulfide bridge: Cys3-Cys21, Cys8-Cys26, Cys12-Cys28) |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.