Shopping Cart
Remove All
Your shopping cart is currently empty
Synonyms:
ProTx II TFA
| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 mg | Inquiry | Inquiry | Inquiry | |
| 50 mg | Inquiry | Inquiry | Inquiry |
| Description | ProTx-II TFA is a potent and highly selective Nav1.7 sodium channel blocker, exhibiting an IC50 of 0.3 nM and demonstrating at least 100-fold selectivity over other sodium channel subtypes. It decreases channel conductance, shifts activation towards more positive potentials, and inhibits action potential propagation in nociceptors [1] [2]. |
| Molecular Weight | 3826.59 (free base) |
| Formula | C168H250N46O41S8.xC2HF3O2 |
| Sequence | Tyr-Cys-Gln-Lys-Trp-Met-Trp-Thr-Cys-Asp-Ser-Glu-Arg-Lys-Cys-Cys-Glu-Gly-Met-Val-Cys-Arg-Leu-Trp-Cys-Lys-Lys-Lys-Leu-Trp (Disulfide bridge:Cys2-Cys16;Cys9-Cys21;Cys15-Cys25) |
| Sequence Short | YCQKWMWTCDSERKCCEGMVCRLWCKKKLW |
| Storage | Powder: -20°C for 3 years | In solvent: -80°C for 1 year Shipping with blue ice/Shipping at ambient temperature. |
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 µL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 µL Tween 80 and mix well until fully clarified.
3) Add 450 µL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.