Shopping Cart
- Remove All
- Your shopping cart is currently empty
Pepinh-MYD, a MyD88 inhibitor, incorporates both a domain sequence from MyD88 TIR and a protein transduction sequence to facilitate cell membrane penetration. This compound disrupts MyD88-mediated TLR signaling pathways, effectively inhibiting associated immune responses. Its design is particularly useful for investigating MyD88's function in viral infections.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
10 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | Pepinh-MYD, a MyD88 inhibitor, incorporates both a domain sequence from MyD88 TIR and a protein transduction sequence to facilitate cell membrane penetration. This compound disrupts MyD88-mediated TLR signaling pathways, effectively inhibiting associated immune responses. Its design is particularly useful for investigating MyD88's function in viral infections. |
Molecular Weight | 3388.03 |
Formula | C151H248N50O35S2 |
Cas No. | 1421052-89-2 |
Sequence | Arg-Gln-Ile-Lys-Ile-Trp-Phe-Gln-Asn-Arg-Arg-Met-Lys-Trp-Lys-Lys-Arg-Asp-Val-Leu-Pro-Gly-Thr-Cys-Val-Asn-Ser-NH2 |
Sequence Short | RQIKIWFQNRRMKWKKRDVLPGTCVNS-NH2 |
Storage | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.