Shopping Cart
- Remove All
- Your shopping cart is currently empty
Pe1b (μ-TrTx-Pe1b) is a selective NaV1.7 channel inhibitor with an inhibitory concentration 50 (IC50) value of 167 nanomolar (nM) [1].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | Pe1b (μ-TrTx-Pe1b) is a selective NaV1.7 channel inhibitor with an inhibitory concentration 50 (IC50) value of 167 nanomolar (nM) [1]. |
Synonyms | μ-TrTx-Pe1b |
Molecular Weight | 3975.43 |
Formula | C175H237N47O49S6 |
Sequence | Glu-Cys-Arg-Tyr-Trp-Leu-Gly-Gly-Cys-Ser-Lys-Thr-Gly-Asp-Cys-Cys-Glu-His-Leu-Ser-Cys-Ser-Pro-Lys-Trp-His-Trp-Cys-Val-Trp-Asp-Gly-Thr-Phe (Disulfide bridge: Cys2-Cys16,Cys9-Cys21,Cys15-Cys28) |
Sequence Short | ECRYWLGGCSKTGDCCEHLSCSPKWHWCVWDGTF (Disulfide bridge: Cys2-Cys16,Cys9-Cys21,Cys15-Cys28) |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.