Your shopping cart is currently empty

pBD-1 is an endogenous and constitutively expressed antimicrobial peptide (AMP) from porcine tissues, particularly expresses in pig mucosal epithelial sites with the contribution of mucosal and systemic host defenses in pigs.

| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 100 mg | Inquiry | Inquiry | Inquiry | |
| 500 mg | Inquiry | Inquiry | Inquiry |
| Description | pBD-1 is an endogenous and constitutively expressed antimicrobial peptide (AMP) from porcine tissues, particularly expresses in pig mucosal epithelial sites with the contribution of mucosal and systemic host defenses in pigs. |
| Targets&IC50 | Antibacterial: |
| In vitro | In a northern blot analysis, pBD-1 mRNA only expresses in tongue epithelial tissues from 4-5 week-old pigs. In RT-PCR analysis, pBD-1 message throughout the epithelia of the respiratory (from the nasal septum to lung) and gastrointestinal (from the esophagus to rectum) tracts. In addition, it is detected in thymus, liver, kidney, urinary bladder, spleen, lymph node, brain, testis, skin, heart, muscle, bone marrow, alveolar macrophages, peripheral blood neutrophils, and the umbilical cord. The only cells that do not express pBD-1 are peripheral blood mononuclear cells. |
| Molecular Weight | 7065.98 |
| Formula | C310H543N91O73S11 |
| Cas No. | 206367-33-1 |
| Relative Density. | no data available |
| Sequence | Asn-Ile-Gly-Asn-Ser-Val-Ser-Cys-Leu-Arg-Asn-Lys-Gly-Val-Cys-Met-Pro-Gly-Lys-Cys-Ala-Pro-Lys-Met-Lys-Gln-Ile-Gly-Thr-Cys-Gly-Met-Pro-Gln-Val-Lys-Cys-Cys-Lys-Arg-Lys (disulfide bridge:Cys1-Cys5,Cys2-Cys4,Cys3-Cys6) |
| Sequence Short | NIGNSVSCLRNKGVCMPGKCAPKMKQIGTCGMPQVKCCKRK (disulfide bridge:Cys1-Cys5,Cys2-Cys4,Cys3-Cys6) |
| Storage | Powder: -20°C for 3 years | In solvent: -80°C for 1 year Shipping with blue ice/Shipping at ambient temperature. |
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.