Shopping Cart
- Remove All
- Your shopping cart is currently empty
Parathyroid hormone (1-34) (rat) (acetate) is a variant that enhances the structure of cortical and cancellous bones and is utilized in osteoporosis research [1] [2].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | Parathyroid hormone (1-34) (rat) (acetate) is a variant that enhances the structure of cortical and cancellous bones and is utilized in osteoporosis research [1] [2]. |
Molecular Weight | 4117.76 |
Formula | C182H295N55O50S2 |
Sequence | Ala-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Ala-Ser-Val-Glu-Arg-Met-Gln-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe |
Sequence Short | AVSEIQLMHNLGKHLASVERMQWLRKKLQDVHNF |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.