Shopping Cart
Remove All
Your shopping cart is currently empty
Melanostatin, frog TFA is a highly efficient α-melanocyte-stimulating hormone (α-MSH) release inhibitor, a 36-amino acid peptide isolated from the frog brain, which modulates the electrophysiological activity of frog melanocytes by regulating K+, Na+, and Ca2+ currents.
| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 1 mg | $195 | - | In Stock | |
| 5 mg | $582 | - | In Stock | |
| 10 mg | $829 | - | In Stock | |
| 25 mg | $1,260 | - | In Stock | |
| 50 mg | $1,680 | - | In Stock | |
| 100 mg | $2,280 | - | In Stock |
| Description | Melanostatin, frog TFA is a highly efficient α-melanocyte-stimulating hormone (α-MSH) release inhibitor, a 36-amino acid peptide isolated from the frog brain, which modulates the electrophysiological activity of frog melanocytes by regulating K+, Na+, and Ca2+ currents. |
| Targets&IC50 | α-MSH:60 nM |
| In vitro | Melanostatin, frog TFA is a potent inhibitor of α-melanocyte-stimulating hormone (α-MSH) release with an IC50 value of 60 nM.At a concentration of 1 μM, Melanostatin, frog TFA enhances potassium currents, while decreasing sodium and calcium currents, thereby inducing hyperpolarization of the cell membrane. [1] |
| Synonyms | Melanostatin, frog TFA(134709-16-3 Free base) |
| Sequence | Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Lys-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2 |
| Sequence Short | YPSKPDNPGEDAPAEDMAKYYSALRHYINLITRQRY |
| Storage | keep away from direct sunlight,keep away from moisture,store at low temperature | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.