Your shopping cart is currently empty

Melanostatin, frog TFA is a highly efficient α-melanocyte-stimulating hormone (α-MSH) release inhibitor, a 36-amino acid peptide isolated from the frog brain, which modulates the electrophysiological activity of frog melanocytes by regulating K+, Na+, and Ca2+ currents.

| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 1 mg | $195 | - | In Stock | |
| 5 mg | $582 | - | In Stock | |
| 10 mg | $829 | - | In Stock | |
| 25 mg | $1,260 | - | In Stock | |
| 50 mg | $1,680 | - | In Stock | |
| 100 mg | $2,280 | - | In Stock |
| Description | Melanostatin, frog TFA is a highly efficient α-melanocyte-stimulating hormone (α-MSH) release inhibitor, a 36-amino acid peptide isolated from the frog brain, which modulates the electrophysiological activity of frog melanocytes by regulating K+, Na+, and Ca2+ currents. |
| Targets&IC50 | α-MSH:60 nM |
| In vitro | Melanostatin, frog TFA is a potent inhibitor of α-melanocyte-stimulating hormone (α-MSH) release with an IC50 value of 60 nM.At a concentration of 1 μM, Melanostatin, frog TFA enhances potassium currents, while decreasing sodium and calcium currents, thereby inducing hyperpolarization of the cell membrane. [1] |
| Synonyms | Melanostatin, frog TFA(134709-16-3 Free base) |
| Sequence | Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Lys-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2 |
| Sequence Short | YPSKPDNPGEDAPAEDMAKYYSALRHYINLITRQRY |
| Storage | keep away from direct sunlight,keep away from moisture,store at low temperature | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.