Shopping Cart
- Remove All
- Your shopping cart is currently empty
LL-37 scrambled peptide acetate, a scrambled version of the cathepsin antimicrobial peptide LL-37, is commonly used as a negative control in experiments involving the LL-37 peptide.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | LL-37 scrambled peptide acetate, a scrambled version of the cathepsin antimicrobial peptide LL-37, is commonly used as a negative control in experiments involving the LL-37 peptide. |
Color | White |
Appearance | Solid |
Sequence | Gly-Leu-Lys-Leu-Arg-Phe-Glu-Phe-Ser-Lys-Ile-Lys-Gly-Glu-Phe-Leu-Lys-Thr-Pro-Glu-Val-Arg-Phe-Arg-Asp-Ile-Lys-Leu-Lys-Asp-Asn-Arg-Ile-Ser-Val-Gln-Arg |
Sequence Short | GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.