Shopping Cart
- Remove All
- Your shopping cart is currently empty
LL-37 scrambled peptide is a rearranged version of the cathelicidin anti-microbial peptide (LL-37).
Pack Size | Price | Availability | Quantity |
---|---|---|---|
1 mg | $211 | Backorder | |
5 mg | $792 | Backorder |
Description | LL-37 scrambled peptide is a rearranged version of the cathelicidin anti-microbial peptide (LL-37). |
Molecular Weight | 4493.3 |
Formula | C205H340N60O53 |
Relative Density. | no data available |
Sequence Short | GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Solubility Information | H2O: Soluble |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.