Shopping Cart
Remove All
Your shopping cart is currently empty
LL-37, Human TFA
Copy Product Info
😃Good
Catalog No. TP1284
LL-37, Human TFA (154947-66-7 free base) is a 37-residue amphipathic helical peptide, the sole human cathelicidin antimicrobial peptide exhibiting moderate antibacterial activity against diverse Gram-negative and Gram-positive bacteria. LL-37, Human TFA binds to negatively charged bacterial membranes, disrupting cellular integrity. It also induces cellular immunomodulation, migration, proliferation, and differentiation, possesses anti-biofilm potential, and inhibits gastric cancer carcinogenesis.
LL-37, Human TFA
LL-37, Human TFA
Copy Product Info😃Good
Purity: 99.95%
Catalog No. TP1284
LL-37, Human TFA (154947-66-7 free base) is a 37-residue amphipathic helical peptide, the sole human cathelicidin antimicrobial peptide exhibiting moderate antibacterial activity against diverse Gram-negative and Gram-positive bacteria. LL-37, Human TFA binds to negatively charged bacterial membranes, disrupting cellular integrity. It also induces cellular immunomodulation, migration, proliferation, and differentiation, possesses anti-biofilm potential, and inhibits gastric cancer carcinogenesis.
| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 1 mg | $97 | - | In Stock | |
| 5 mg | $215 | - | In Stock | |
| 10 mg | $340 | - | In Stock | |
| 25 mg | $680 | - | In Stock | |
| 50 mg | $1,095 | - | In Stock | |
| 100 mg | $1,740 | - | In Stock |
Add to Cart
Add to Quotation
In Stock Estimated shipping dateUSA Warehouse[1-2 days] Global Warehouse[5-7 days]
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Batch Information
Select Batch
Purity:99.95%
Appearance:Solid
Color:White
Contact us for more batch information
Product Introduction
Bioactivity
Chemical Properties
Storage & Solubility Information
| Description | LL-37, Human TFA (154947-66-7 free base) is a 37-residue amphipathic helical peptide, the sole human cathelicidin antimicrobial peptide exhibiting moderate antibacterial activity against diverse Gram-negative and Gram-positive bacteria. LL-37, Human TFA binds to negatively charged bacterial membranes, disrupting cellular integrity. It also induces cellular immunomodulation, migration, proliferation, and differentiation, possesses anti-biofilm potential, and inhibits gastric cancer carcinogenesis. |
| In vitro | Methods: HCECs were treated with LL-37, Human TFA (1-20 μg/mL, 24 h) to investigate the effect of LL-37 on cell migration. Results: LL-37, Human TFA dose-dependently promoted HCECs migration but had no effect on cell proliferation. [2] |
| In vivo | Methods: LL-37, Human TFA (0.4-2.0 mg/kg, single dose) was administered via intratracheal injection to C57BL/6 mice to investigate the effects of LL-37 in an MRSA-induced pneumonia model. Results: LL-37 alleviated MRSA-induced inflammatory response by reducing the expression of IL-6 and TNF-α in vivo.[3] |
| Molecular Weight | 4607.28 |
| Formula | C205H340N60O53.C2HF3O2 |
| Relative Density. | no data available |
| Sequence | H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH.CH3CO2H |
| Sequence Short | LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. | |||||||||||||||||||||||||
| Solubility Information | H2O: 80 mg/mL (17.36 mM), Sonication is recommended. DMSO: 40 mg/mL (8.68 mM), Sonication is recommended. | |||||||||||||||||||||||||
Solution Preparation Table | ||||||||||||||||||||||||||
DMSO/H2O
H2O
| ||||||||||||||||||||||||||
Calculator
In Vivo Formulation Calculator (Clear solution)
Please enter your animal experiment information in the following box and click Calculate to obtain the stock solution preparation method and in vivo formula preparation method:
For example, if the intended dosage is 10 mg/kg for animals weighing 20 g , with a dosing volume of 100 μL per animal, and a total of 10 animals are to be administered, using a formulation of 
10% DMSO+ 40% PEG300+ 5% Tween 80+ 45% Saline/PBS/ddH2O , the resulting working solution concentration would be 2 mg/mL.Stock Solution Preparation:
Dissolve 2 mg of the compound in 100 μL DMSO to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
Preparation of the In Vivo Formulation:
1) Add 100 μL of the DMSO stock solution to 400 μL PEG300 and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O and mix thoroughly until a homogeneous solution is obtained.
This example is provided solely to demonstrate the use of the In Vivo Formulation Calculator and does not constitute a recommended formulation for any specific compound. Please select an appropriate dissolution and formulation strategy based on your experimental model and route of administration.
Dose Conversion
You can also refer to dose conversion for different animals. More Dose Conversion
Tech Support
Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc
Keywords
Preview
Related Tags: buy LL-37, Human TFA | purchase LL-37, Human TFA | LL-37, Human TFA cost | order LL-37, Human TFA | LL-37, Human TFA in vivo | LL-37, Human TFA in vitro | LL-37, Human TFA formula | LL-37, Human TFA molecular weight
Generate Quote
Catalog No.: Cas No.:
Add
| Size | Quantity | Unit Price | Amount | Operation |
|---|
Generate Quote
- TOP
Feedback
Hello! How can I help you today? 
Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.