Your shopping cart is currently empty

LL-37, Human TFA (154947-66-7 free base) is a 37-residue amphipathic helical peptide, the sole human cathelicidin antimicrobial peptide exhibiting moderate antibacterial activity against diverse Gram-negative and Gram-positive bacteria. LL-37, Human TFA binds to negatively charged bacterial membranes, disrupting cellular integrity. It also induces cellular immunomodulation, migration, proliferation, and differentiation, possesses anti-biofilm potential, and inhibits gastric cancer carcinogenesis.
| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 1 mg | $97 | - | In Stock | |
| 5 mg | $215 | - | In Stock | |
| 10 mg | $340 | - | In Stock | |
| 25 mg | $680 | - | In Stock | |
| 50 mg | $1,095 | - | In Stock | |
| 100 mg | $1,740 | - | In Stock |
| Description | LL-37, Human TFA (154947-66-7 free base) is a 37-residue amphipathic helical peptide, the sole human cathelicidin antimicrobial peptide exhibiting moderate antibacterial activity against diverse Gram-negative and Gram-positive bacteria. LL-37, Human TFA binds to negatively charged bacterial membranes, disrupting cellular integrity. It also induces cellular immunomodulation, migration, proliferation, and differentiation, possesses anti-biofilm potential, and inhibits gastric cancer carcinogenesis. |
| In vitro | Methods: HCECs were treated with LL-37, Human TFA (1-20 μg/mL, 24 h) to investigate the effect of LL-37 on cell migration. Results: LL-37, Human TFA dose-dependently promoted HCECs migration but had no effect on cell proliferation. [2] |
| In vivo | Methods: LL-37, Human TFA (0.4-2.0 mg/kg, single dose) was administered via intratracheal injection to C57BL/6 mice to investigate the effects of LL-37 in an MRSA-induced pneumonia model. Results: LL-37 alleviated MRSA-induced inflammatory response by reducing the expression of IL-6 and TNF-α in vivo.[3] |
| Molecular Weight | 4607.28 |
| Formula | C205H340N60O53.C2HF3O2 |
| Relative Density. | no data available |
| Sequence | H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH.CH3CO2H |
| Sequence Short | [LL-37, 37 aa] |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. | |||||||||||||||||||||||||
| Solubility Information | H2O: 80 mg/mL (17.36 mM), Sonication is recommended. DMSO: 40 mg/mL (8.68 mM), Sonication is recommended. | |||||||||||||||||||||||||
Solution Preparation Table | ||||||||||||||||||||||||||
DMSO/H2O
H2O
Note : The dilution table applies only to solid products. For liquid products, please calculate the stock solution based on the stated concentration and/or density. | ||||||||||||||||||||||||||
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.