Shopping Cart
Remove All
Your shopping cart is currently empty
LL-37, Human TFA (154947-66-7 free base) is a 37-residue amphipathic helical peptide, the sole human cathelicidin antimicrobial peptide exhibiting moderate antibacterial activity against diverse Gram-negative and Gram-positive bacteria. LL-37, Human TFA binds to negatively charged bacterial membranes, disrupting cellular integrity. It also induces cellular immunomodulation, migration, proliferation, and differentiation, possesses anti-biofilm potential, and inhibits gastric cancer carcinogenesis.
| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 1 mg | $97 | - | In Stock | |
| 5 mg | $215 | - | In Stock | |
| 10 mg | $340 | - | In Stock | |
| 25 mg | $680 | - | In Stock | |
| 50 mg | $1,095 | - | In Stock | |
| 100 mg | $1,740 | - | In Stock |
| Description | LL-37, Human TFA (154947-66-7 free base) is a 37-residue amphipathic helical peptide, the sole human cathelicidin antimicrobial peptide exhibiting moderate antibacterial activity against diverse Gram-negative and Gram-positive bacteria. LL-37, Human TFA binds to negatively charged bacterial membranes, disrupting cellular integrity. It also induces cellular immunomodulation, migration, proliferation, and differentiation, possesses anti-biofilm potential, and inhibits gastric cancer carcinogenesis. |
| In vitro | Methods: HCECs were treated with LL-37, Human TFA (1-20 μg/mL, 24 h) to investigate the effect of LL-37 on cell migration. Results: LL-37, Human TFA dose-dependently promoted HCECs migration but had no effect on cell proliferation. [2] |
| In vivo | Methods: LL-37, Human TFA (0.4-2.0 mg/kg, single dose) was administered via intratracheal injection to C57BL/6 mice to investigate the effects of LL-37 in an MRSA-induced pneumonia model. Results: LL-37 alleviated MRSA-induced inflammatory response by reducing the expression of IL-6 and TNF-α in vivo.[3] |
| Molecular Weight | 4607.28 |
| Formula | C205H340N60O53.C2HF3O2 |
| Relative Density. | no data available |
| Color | White |
| Appearance | Solid |
| Sequence | H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH.CH3CO2H |
| Sequence Short | [LL-37, 37 aa] |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. | |||||||||||||||||||||||||
| Solubility Information | H2O: 80 mg/mL (17.36 mM), Sonication is recommended. DMSO: 40 mg/mL (8.68 mM), Sonication is recommended. | |||||||||||||||||||||||||
Solution Preparation Table | ||||||||||||||||||||||||||
DMSO/H2O
H2O
| ||||||||||||||||||||||||||
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.