Shopping Cart
- Remove All
- Your shopping cart is currently empty
Human LL-37 is a 37 amino acid cationic (6+) peptide and has been widely studied. LL-37 penetrates the bacterial membrane and forms pores in the membrane.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
1 mg | $211 | Backorder | |
5 mg | $751 | Backorder |
Description | Human LL-37 is a 37 amino acid cationic (6+) peptide and has been widely studied. LL-37 penetrates the bacterial membrane and forms pores in the membrane. |
Alias | LL-37, Human TFA |
Molecular Weight | 4607.28 |
Formula | C205H340N60O53.C2HF3O2 |
Relative Density. | no data available |
Sequence | H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH.CH3CO2H |
Sequence Short | H-LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES-OH |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.