Shopping Cart
- Remove All
- Your shopping cart is currently empty
Kaliotoxin is an inhibitor of neuronal BK-type peptide groups and specifically inhibits Kv channels and calcium-activated potassium channels. Kaliotoxin has research significance on the regulation of cell membrane potential and neuronal excitability. The product number is T37808 and the CAS number is 145199-73-1
Pack Size | Price | Availability | Quantity |
---|---|---|---|
1 mg | $1,490 | Backorder |
Description | Kaliotoxin is an inhibitor of neuronal BK-type peptide groups and specifically inhibits Kv channels and calcium-activated potassium channels. Kaliotoxin has research significance on the regulation of cell membrane potential and neuronal excitability. The product number is T37808 and the CAS number is 145199-73-1 |
Molecular Weight | 4149.94 |
Formula | C171H283N55O49S8 |
Cas No. | 145199-73-1 |
Sequence | Gly-Val-Glu-Ile-Asn-Val-Lys-Cys-Ser-Gly-Ser-Pro-Gln-Cys-Leu-Lys-Pro-Cys-Lys-Asp-Ala-Gly-Met-Arg-Phe-Gly-Lys-Cys-Met-Asn-Arg-Lys-Cys-His-Cys-Thr-Pro-Lys (Disulfide bridge: Cys8-Cys28;Cys14-Cys33;Cys18-Cys35) |
Sequence Short | GVEINVKCSGSPQCLKPCKDAGMRFGKCMNRKCHCTPK (Disulfide bridge: Cys8-Cys28;Cys14-Cys33;Cys18-Cys35) |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Solubility Information | H2O: 2 mg/mL (0.48 mM), Sonication is recommended. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.