Shopping Cart
- Remove All
- Your shopping cart is currently empty
Jingzhaotoxin-II, a neurotoxin composed of 32 amino acid residues featuring two acidic and two basic residues, selectively inhibits voltage-gated sodium channels (VGSC), notably slowing the rapid inactivation of TTX-resistant (TTX-R) VGSC in cardiac myocytes, with an IC50 of 0.26 μM [1].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | Jingzhaotoxin-II, a neurotoxin composed of 32 amino acid residues featuring two acidic and two basic residues, selectively inhibits voltage-gated sodium channels (VGSC), notably slowing the rapid inactivation of TTX-resistant (TTX-R) VGSC in cardiac myocytes, with an IC50 of 0.26 μM [1]. |
Molecular Weight | 3561.08 |
Formula | C154H219N39O45S7 |
Sequence | Gly-Cys-Gly-Thr-Met-Trp-Ser-Pro-Cys-Ser-Thr-Glu-Lys-Pro-Cys-Cys-Asp-Asn-Phe-Ser-Cys-Gln-Pro-Ala-Ile-Lys-Trp-Cys-Ile-Trp-Ser-Pro (Disulfide bridge:Cys2-Cys16;Cys9-Cys21;Cys15-Cys28) |
Sequence Short | GCGTMWSPCSTEKPCCDNFSCQPAIKWCIWSP (Disulfide bridge:Cys2-Cys16;Cys9-Cys21;Cys15-Cys28) |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.