Shopping Cart
- Remove All
 Your shopping cart is currently empty Your shopping cart is currently empty
Jingzhaotoxin-II, a neurotoxin composed of 32 amino acid residues featuring two acidic and two basic residues, selectively inhibits voltage-gated sodium channels (VGSC), notably slowing the rapid inactivation of TTX-resistant (TTX-R) VGSC in cardiac myocytes, with an IC50 of 0.26 μM [1].
| Pack Size | Price | Availability | Quantity | 
|---|---|---|---|
| 5 mg | Inquiry | Backorder | |
| 50 mg | Inquiry | Backorder | 
| Description | Jingzhaotoxin-II, a neurotoxin composed of 32 amino acid residues featuring two acidic and two basic residues, selectively inhibits voltage-gated sodium channels (VGSC), notably slowing the rapid inactivation of TTX-resistant (TTX-R) VGSC in cardiac myocytes, with an IC50 of 0.26 μM [1]. | 
| Molecular Weight | 3561.08 | 
| Formula | C154H219N39O45S7 | 
| Sequence | Gly-Cys-Gly-Thr-Met-Trp-Ser-Pro-Cys-Ser-Thr-Glu-Lys-Pro-Cys-Cys-Asp-Asn-Phe-Ser-Cys-Gln-Pro-Ala-Ile-Lys-Trp-Cys-Ile-Trp-Ser-Pro (Disulfide bridge:Cys2-Cys16;Cys9-Cys21;Cys15-Cys28) | 
| Sequence Short | GCGTMWSPCSTEKPCCDNFSCQPAIKWCIWSP (Disulfide bridge:Cys2-Cys16;Cys9-Cys21;Cys15-Cys28) | 
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. | 
 For example, your dosage is 10 mg/kg Each animal weighs 20 g, and the dosage volume is 100 μL .
For example, your dosage is 10 mg/kg Each animal weighs 20 g, and the dosage volume is 100 μL .  A total of 10 animals were administered, and the formula you used is 5%
 A total of 10 animals were administered, and the formula you used is 5%  DMSO+30% PEG300+5% Tween 80+60% Saline/PBS/ddH2O. So your working solution concentration is 2 mg/mL。
DMSO+30% PEG300+5% Tween 80+60% Saline/PBS/ddH2O. So your working solution concentration is 2 mg/mL。 (mother liquor concentration of 40 mg/mL), if you need to configure a concentration that exceeds the solubility of the product, please contact us first.
 (mother liquor concentration of 40 mg/mL), if you need to configure a concentration that exceeds the solubility of the product, please contact us first. main solution, add 300 μLPEG300
 main solution, add 300 μLPEG300 mix well and clarify, then add 50 more μL Tween 80, mix well and clarify, then add 600 more μLSaline/PBS/ddH2O
 mix well and clarify, then add 50 more μL Tween 80, mix well and clarify, then add 600 more μLSaline/PBS/ddH2O mix well and clarify
 mix well and clarify
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.