Your shopping cart is currently empty

Helospectin II, a member of the vasoactive intestinal peptide (VIP) family, exhibits vasodilatory and antihypertensive properties that reduce blood pressure. This neuropeptide was initially isolated from the venom of the salivary glands of the Heloderma suspectum lizard [1] [2].

| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 mg | Inquiry | Inquiry | Inquiry | |
| 50 mg | Inquiry | Inquiry | Inquiry |
| Description | Helospectin II, a member of the vasoactive intestinal peptide (VIP) family, exhibits vasodilatory and antihypertensive properties that reduce blood pressure. This neuropeptide was initially isolated from the venom of the salivary glands of the Heloderma suspectum lizard [1] [2]. |
| In vitro | Helospectin II exhibits activity through suffusion at 0. |
| In vivo | Helospectin II, administered at doses ranging from 0.03 to 2 nmol/kg via a 100 μL infusion into the left jugular vein, effectively lowers blood pressure in rats [2]. |
| Cas No. | 93585-83-2 |
| Sequence | His-Ser-Asp-Ala-Thr-Phe-Thr-Ala-Glu-Tyr-Ser-Lys-Leu-Leu-Ala-Lys-Leu-Ala-Leu-Gln-Lys-Tyr-Leu-Glu-Ser-Ile-Leu-Gly-Ser-Ser-Thr-Ser-Pro-Arg-Pro-Pro-Ser |
| Sequence Short | HSDATFTAEYSKLLAKLALQKYLESILGSSTSPRPPS |
| Storage | Powder: -20°C for 3 years | In solvent: -80°C for 1 year Shipping with blue ice/Shipping at ambient temperature. |
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.