Shopping Cart
- Remove All
Your shopping cart is currently empty
Helospectin II, a member of the vasoactive intestinal peptide (VIP) family, exhibits vasodilatory and antihypertensive properties that reduce blood pressure. This neuropeptide was initially isolated from the venom of the salivary glands of the Heloderma suspectum lizard [1] [2].
| Pack Size | Price | Availability | Quantity |
|---|---|---|---|
| 5 mg | Inquiry | Backorder | |
| 50 mg | Inquiry | Backorder |
| Description | Helospectin II, a member of the vasoactive intestinal peptide (VIP) family, exhibits vasodilatory and antihypertensive properties that reduce blood pressure. This neuropeptide was initially isolated from the venom of the salivary glands of the Heloderma suspectum lizard [1] [2]. |
| In vitro | Helospectin II exhibits activity through suffusion at 0. |
| In vivo | Helospectin II, administered at doses ranging from 0.03 to 2 nmol/kg via a 100 μL infusion into the left jugular vein, effectively lowers blood pressure in rats [2]. |
| Cas No. | 93585-83-2 |
| Sequence | His-Ser-Asp-Ala-Thr-Phe-Thr-Ala-Glu-Tyr-Ser-Lys-Leu-Leu-Ala-Lys-Leu-Ala-Leu-Gln-Lys-Tyr-Leu-Glu-Ser-Ile-Leu-Gly-Ser-Ser-Thr-Ser-Pro-Arg-Pro-Pro-Ser |
| Sequence Short | HSDATFTAEYSKLLAKLALQKYLESILGSSTSPRPPS |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |

Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.