Your shopping cart is currently empty

Helospectin I, a neuropeptide belonging to the vasoactive intestinal peptide (VIP) family, exhibits vasodilatory and antihypertensive properties, effectively reducing blood pressure. It was initially isolated from the salivary gland venom of the lizard Heloderma suspectum [1] [2].

| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 mg | Inquiry | Inquiry | Inquiry | |
| 50 mg | Inquiry | Inquiry | Inquiry |
| Description | Helospectin I, a neuropeptide belonging to the vasoactive intestinal peptide (VIP) family, exhibits vasodilatory and antihypertensive properties, effectively reducing blood pressure. It was initially isolated from the salivary gland venom of the lizard Heloderma suspectum [1] [2]. |
| In vivo | Helospectin I, administered intravenously at doses ranging from 0.03 to 2 nmol/kg, lowers blood pressure in rats when infused at a volume of 100 μL into the left jugular vein [2]. At a dosage of 0.1 to 0.8 nmol/kg, this compound also elevates plasma glucagon concentrations in mice [3]. |
| Cas No. | 93438-37-0 |
| Sequence | H-His-Ser-Asp-Ala-Thr-Phe-Thr-Ala-Glu-Tyr-Ser-Lys-Leu-Leu-Ala-Lys-Leu-Ala-Leu-Gln-Lys-Tyr-Leu-Glu-Ser-Ile-Leu-Gly-Ser-Ser-Thr-Ser-Pro-Arg-Pro-Pro-Ser-Ser-OH |
| Sequence Short | HSDATFTAEYSKLLAKLALQKYLESILGSSTSPRPPSS |
| Storage | Powder: -20°C for 3 years | In solvent: -80°C for 1 year Shipping with blue ice/Shipping at ambient temperature. |
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.