Shopping Cart
Remove All
Your shopping cart is currently empty
Helospectin I, a neuropeptide belonging to the vasoactive intestinal peptide (VIP) family, exhibits vasodilatory and antihypertensive properties, effectively reducing blood pressure. It was initially isolated from the salivary gland venom of the lizard Heloderma suspectum [1] [2].
| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 5 mg | Inquiry | Backorder | Backorder | |
| 50 mg | Inquiry | Backorder | Backorder |
| Description | Helospectin I, a neuropeptide belonging to the vasoactive intestinal peptide (VIP) family, exhibits vasodilatory and antihypertensive properties, effectively reducing blood pressure. It was initially isolated from the salivary gland venom of the lizard Heloderma suspectum [1] [2]. |
| In vivo | Helospectin I, administered intravenously at doses ranging from 0.03 to 2 nmol/kg, lowers blood pressure in rats when infused at a volume of 100 μL into the left jugular vein [2]. At a dosage of 0.1 to 0.8 nmol/kg, this compound also elevates plasma glucagon concentrations in mice [3]. |
| Cas No. | 93438-37-0 |
| Sequence Short | HSDATFTAEYSKLLAKLALQKYLESILGSSTSPRPPSS |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.