Shopping Cart
- Remove All
- Your shopping cart is currently empty
Mammalian bombesin-like peptide neurotransmitter that is an agonist for the gastrin-releasing peptide receptor (GRPR). GRP has been reported to activate GABAergic interneurons in the amygdala leading to increased GABA release and fear suppression in mice in vivo. Also involved in mitogenesis, and GI tract and appetite regulation.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
1 mg | $252 | Backorder |
Description | Mammalian bombesin-like peptide neurotransmitter that is an agonist for the gastrin-releasing peptide receptor (GRPR). GRP has been reported to activate GABAergic interneurons in the amygdala leading to increased GABA release and fear suppression in mice in vivo. Also involved in mitogenesis, and GI tract and appetite regulation. |
Molecular Weight | 2805.31 |
Formula | C126H198N38O31S2 |
Cas No. | 74815-57-9 |
Relative Density. | 1.46 g/cm3 (Predicted) |
Sequence | Ala-Pro-Val-Ser-Val-Gly-Gly-Gly-Thr-Val-Leu-Ala-Lys-Met-Tyr-Pro-Arg-Gly-Asn-His-Trp-Ala-Val-Gly-His-Leu-Met-NH2 |
Sequence Short | APVSVGGGTVLAKMYPRGNHWAVGHLM-NH2 |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Solubility Information | H2O: 1 mg/mL (0.36 mM), Sonication is recommended. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.