Shopping Cart
- Remove All
- Your shopping cart is currently empty
[DPro5] Corticotropin Releasing Factor, human, rat, a selective R2 agonist of corticotropin-releasing factor/hormone (CRF), is a hypothalamic hormone that prompts the release of adrenocorticotropic hormone (ACTH) and β-endorphin. Unlike typical agents, it does not induce anxiogenic effects but instead influences learning and memory processes in rats [1].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | [DPro5] Corticotropin Releasing Factor, human, rat, a selective R2 agonist of corticotropin-releasing factor/hormone (CRF), is a hypothalamic hormone that prompts the release of adrenocorticotropic hormone (ACTH) and β-endorphin. Unlike typical agents, it does not induce anxiogenic effects but instead influences learning and memory processes in rats [1]. |
Molecular Weight | 4757.45 |
Formula | C208H344N60O63S2 |
Cas No. | 195628-97-8 |
Sequence Short | SEEP-{d-Pro}-ISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2 |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.