Shopping Cart
- Remove All
- Your shopping cart is currently empty
CTCE-0214, a chemokine CXC receptor 4 (CXCR4) agonist and SDF-1α (stromal cell-derived factor-1α) peptide analog, exhibits anti-inflammatory properties. It is applicable in the research of inflammation, sepsis, and systemic inflammatory syndromes [1] [2] [3].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | CTCE-0214, a chemokine CXC receptor 4 (CXCR4) agonist and SDF-1α (stromal cell-derived factor-1α) peptide analog, exhibits anti-inflammatory properties. It is applicable in the research of inflammation, sepsis, and systemic inflammatory syndromes [1] [2] [3]. |
Cas No. | 577782-52-6 |
Sequence Short | KPVSLSYRAPFRFFGGGGLKWIQEYLEKALN-NH2 (Lactam:Lys20-Glu24) |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.