Shopping Cart
- Remove All
- Your shopping cart is currently empty
Crotamine, a 42 amino acid toxin featuring three disulfide bridges, functions as a Na+ channel modulator with analgesic properties. This compound interacts with lipid membranes and exhibits myonecrotic activity, and can be isolated from the venom of Crotalus durissus terrificus [1] [2].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | Crotamine, a 42 amino acid toxin featuring three disulfide bridges, functions as a Na+ channel modulator with analgesic properties. This compound interacts with lipid membranes and exhibits myonecrotic activity, and can be isolated from the venom of Crotalus durissus terrificus [1] [2]. |
Molecular Weight | 4883.73 |
Formula | C214H326N64O54S7 |
Sequence | Tyr-Lys-Gln-Cys-His-Lys-Lys-Gly-Gly-His-Cys-Phe-Pro-Lys-Glu-Lys-Ile-Cys-Leu-Pro-Pro-Ser-Ser-Asp-Phe-Gly-Lys-Met-Asp-Cys-Arg-Trp-Arg-Trp-Lys-Cys-Cys-Lys-Lys-Gly-Ser-Gly (Disulfide bonds:Cys4-Cys36, Cys11-Cys30, Cys18-Cys37) |
Sequence Short | YKQCHKKGGHCFPKEKICLPPSSDFGKMDCRWRWKCCKKGSG (Disulfide bonds:Cys4-Cys36, Cys11-Cys30, Cys18-Cys37) |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.