Shopping Cart
Remove All
Your shopping cart is currently empty
Synonyms:
Compstatin TFA
| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 mg | Inquiry | Inquiry | Inquiry | |
| 50 mg | Inquiry | Inquiry | Inquiry |
| Description | Compstatin TFA, a potent inhibitor of the complement system C3 characterized by species specificity, is a 13-residue cyclic peptide. It selectively binds to baboon C3 and demonstrates resistance to proteolytic cleavage in baboon blood (similar to humans), effectively inhibiting the activation of the primate complement system. Notably, Compstatin TFA exhibits IC 50 values of 63 μM and 12 μM for the classical and alternative complement pathways, respectively [1] [2] [3]. |
| Molecular Weight | 1664.79 |
| Formula | C68H100F3N23O19S2 |
| Sequence | Ile-Cys-Val-Val-Gln-Asp-Trp-Gly-His-His-Arg-Cys-Thr-Asp-Ile-Ser-Leu-Phe-Ile-Asp-Glu-Arg-Ile-Asp-Gly-Glu-Cys-Tyr-Ser-Cys-Tyr-Ser |
| Sequence Short | ICVVQDWGHHRCTDISLFIDERIDGECYSCYS |
| Storage | Keep away from moisture Powder: -20°C for 3 years | In solvent: -80°C for 1 year Shipping with blue ice/Shipping at ambient temperature. |
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 µL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 µL Tween 80 and mix well until fully clarified.
3) Add 450 µL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.