Shopping Cart
- Remove All
- Your shopping cart is currently empty
CNP-38, a C-type natriuretic peptide (CNP) analog.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | CNP-38, a C-type natriuretic peptide (CNP) analog. |
In vivo | CNP-38 (subcutaneous injection, 800 µg/kg, single dose) was found to reduce the blood pressure in male telemetry-adult Crl:CD1(ICR) mice [1]. Furthermore, administration of CNP-38 (either by subcutaneous injection or continuous infusion, 203 µg/kg, daily for 5 weeks) significantly promoted axial and appendicular skeletal growth in mice, with the continuous infusion method showing a more pronounced effect [1]. |
Molecular Weight | 4061.72 |
Formula | C175H291N55O50S3 |
Sequence | Leu-Gln-Glu-His-Pro-Asn-Ala-Arg-Lys-Tyr-Lys-Gly-Ala-Asn-Lys-Lys-Gly-Leu-Ser-Lys-Gly-Cys-Phe-Gly-Leu-Lys-Leu-Asp-Arg-Ile-Gly-Ser-Met-Ser-Gly-Leu-Gly-Cys (Disulfide bridge: Cys22-Cys38) |
Sequence Short | LQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC (Disulfide bridge: Cys22-Cys38) |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.