Shopping Cart
- Remove All
Your shopping cart is currently empty
Ceratotoxin-2 (CcoTx2) is a voltage-gated sodium channel inhibitor with half maximal inhibitory concentrations (IC50) of 8 nM for Na v 1.2/β 1 and 88 nM for Na v 1.3/β 1 [1].
| Pack Size | Price | Availability | Quantity |
|---|---|---|---|
| 5 mg | Inquiry | Backorder | |
| 50 mg | Inquiry | Backorder |
| Description | Ceratotoxin-2 (CcoTx2) is a voltage-gated sodium channel inhibitor with half maximal inhibitory concentrations (IC50) of 8 nM for Na v 1.2/β 1 and 88 nM for Na v 1.3/β 1 [1]. |
| Synonyms | β-TRTX-cm1b, CcoTx2 |
| Molecular Weight | 4092.67 |
| Formula | C177H260N52O49S6 |
| Cas No. | 880885-98-3 |
| Sequence | Asp-Cys-Leu-Gly-Trp-Phe-Lys-Ser-Cys-Asp-Pro-Lys-Asn-Asp-Lys-Cys-Cys-Lys-Asn-Tyr-Thr-Cys-Ser-Arg-Arg-Asp-Arg-Trp-Cys-Lys-Tyr-Tyr-Leu-NH2 (Disulfide bridge:Cys2-Cys17;Cys9-Cys22;Cys16-Cys29) |
| Sequence Short | DCLGWFKSCDPKNDKCCKNYTCSRRDRWCKYYL-NH2 (Disulfide bridge:Cys2-Cys17;Cys9-Cys22;Cys16-Cys29) |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |

Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.