Shopping Cart
- Remove All
- Your shopping cart is currently empty
Brain Natriuretic Peptide (BNP) (1-32), rat is a 32 amino acid polypeptide secreted by the ventricles of the heart in response to excessive stretching of heart muscle cells (cardiomyocytes).Brain natriuretic peptide (type B natriuretic peptide) was originally isolated from brain, but is mainly produced in myoendocrine cells of the heart ventricles from which it is released into the circulation.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
1 mg | $319 | Backorder | |
5 mg | $918 | Backorder |
Description | Brain Natriuretic Peptide (BNP) (1-32), rat is a 32 amino acid polypeptide secreted by the ventricles of the heart in response to excessive stretching of heart muscle cells (cardiomyocytes).Brain natriuretic peptide (type B natriuretic peptide) was originally isolated from brain, but is mainly produced in myoendocrine cells of the heart ventricles from which it is released into the circulation. |
Alias | Brain Natriuretic Peptide (BNP) (1-32), rat |
Molecular Weight | 3452.94 |
Formula | C146H239N47O44S3 |
Cas No. | 133448-20-1 |
Relative Density. | 1.50 g/cm3 (Predicted) |
Sequence | Asn-Ser-Lys-Met-Ala-His-Ser-Ser-Ser-Cys-Phe-Gly-Gln-Lys-Ile-Asp-Arg-Ile-Gly-Ala-Val-Ser-Arg-Leu-Gly-Cys-Asp-Gly-Leu-Arg-Leu-Phe (Disulfide bridge: Cys10-Cys26) |
Sequence Short | NSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF (Disulfide bridge: Cys10-Cys26) |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice. |
Solubility Information | H2O: Soluble |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.