Shopping Cart
- Remove All
- Your shopping cart is currently empty
BmK-M1, a scorpion-derived toxin, consists of a 64-amino acid polypeptide stabilized by four disulfide bridges. This compound functions as an inhibitor of the Na+ channel, classifying it as both a cardiotoxin and a neurotoxin [1].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | BmK-M1, a scorpion-derived toxin, consists of a 64-amino acid polypeptide stabilized by four disulfide bridges. This compound functions as an inhibitor of the Na+ channel, classifying it as both a cardiotoxin and a neurotoxin [1]. |
Molecular Weight | 7217.13 |
Formula | C313H467N91O91S8 |
Sequence | Val-Arg-Asp-Ala-Tyr-Ile-Ala-Lys-Pro-His-Asn-Cys-Val-Tyr-Glu-Cys-Ala-Arg-Asn-Glu-Tyr-Cys-Asn-Asp-Leu-Cys-Thr-Lys-Asn-Gly-Ala-Lys-Ser-Gly-Tyr-Cys-Gln-Trp-Val-Gly-Lys-Tyr-Gly-Asn-Gly-Cys-Trp-Cys-Ile-Glu-Leu-Pro-Asp-Asn-Val-Pro-Ile-Arg-Val-Pro-Gly-Lys-Cys-His |
Sequence Short | VRDAYIAKPHNCVYECARNEYCNDLCTKNGAKSGYCQWVGKYGNGCWCIELPDNVPIRVPGKCH (Disulfide bridge:Cys12-Cys63;Cys16-Cys36;Cys22-Cys46;Cys26-Cys48) |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.