Shopping Cart
- Remove All
- Your shopping cart is currently empty
BeKm-1 TFA is a potent, selective blocker of the KV11.1 (hERG) channel, demonstrating specificity for KV11.1 over 14 other potassium channels. This compound dose-dependently prolongs the QTc interval in isolated rabbit hearts, affirming its role as a selective inhibitor.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | BeKm-1 TFA is a potent, selective blocker of the KV11.1 (hERG) channel, demonstrating specificity for KV11.1 over 14 other potassium channels. This compound dose-dependently prolongs the QTc interval in isolated rabbit hearts, affirming its role as a selective inhibitor. |
Molecular Weight | 4205.67 |
Formula | C176H262F3N51O54S6 |
Sequence | Arg-Pro-Thr-Asp-Ile-Lys-Cys-Ser-Glu-Ser-Tyr-Gln-Cys-Phe-Pro-Val-Cys-Lys-Ser-Arg-Phe-Gly-Lys-Thr-Asn-Gly-Arg-Cys-Val-Asn-Gly-Phe-Cys-Asp-Cys-Phe (Disulfide bridge:Cys13-Cys33;Cys17-Cys35;Cys7-Cys28) |
Sequence Short | RPTDIKCSESYQCFPVCKSRFGKTNGRCVNGFCDCF (Disulfide bridge:Cys13-Cys33;Cys17-Cys35;Cys7-Cys28) |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.