Shopping Cart
- Remove All
Your shopping cart is currently empty
AmmTX3 TFA, a peptide toxin derived from Androctonus mauretanicus scorpion venom, functions as a selective blocker of the K_v4 channel. It inhibits the A-type K^+ current with an inhibition constant (K_i) of 131 nM [1] [2].
| Pack Size | Price | Availability | Quantity |
|---|---|---|---|
| 5 mg | Inquiry | Backorder | |
| 50 mg | Inquiry | Backorder |
| Description | AmmTX3 TFA, a peptide toxin derived from Androctonus mauretanicus scorpion venom, functions as a selective blocker of the K_v4 channel. It inhibits the A-type K^+ current with an inhibition constant (K_i) of 131 nM [1] [2]. |
| Molecular Weight | 3822.47 (free acid) |
| Formula | C158H262N50O48S6.xC2HF3O2 |
| Sequence | {Glp}-Ile-Glu-Thr-Asn-Lys-Lys-Cys-Gln-Gly-Gly-Ser-Cys-Ala-Ser-Val-Cys-Arg-Lys-Val-Ile-Gly-Val-Ala-Ala-Gly-Lys-Cys-Ile-Asn-Gly-Arg-Cys-Val-Cys-Tyr-Pro (Disulfide bonds: Cys8-Cys28, Cys13-Cys33, Cys17-Cys35) (TFA salt) |
| Sequence Short | {Glp}-IETNKKCQGGSCASVCRKVIGVAAGKCINGRCVCYP (Disulfide bonds: Cys8-Cys28, Cys13-Cys33, Cys17-Cys35) (TFA salt) |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |

Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.