Shopping Cart
- Remove All
- Your shopping cart is currently empty
KV4 channel blocker. Blocks A-type K+ current (ISA) in mouse cerebellar granule neurons. The accessory dipeptidyl peptidase-like proteins (DPP) 6 and 10 are required for blockade.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | $2,379 | Backorder |
Description | KV4 channel blocker. Blocks A-type K+ current (ISA) in mouse cerebellar granule neurons. The accessory dipeptidyl peptidase-like proteins (DPP) 6 and 10 are required for blockade. |
Molecular Weight | 3822.47 |
Formula | C158H262N50O48S6 |
Relative Density. | 1.31g/cm3 |
Sequence | {Glp}-Ile-Glu-Thr-Asn-Lys-Lys-Cys-Gln-Gly-Gly-Ser-Cys-Ala-Ser-Val-Cys-Arg-Lys-Val-Ile-Gly-Val-Ala-Ala-Gly-Lys-Cys-Ile-Asn-Gly-Arg-Cys-Val-Cys-Tyr-Pro (Disulfide bonds:Cys8-Cys28, Cys13-Cys33 and Cys17-Cys35) |
Sequence Short | {Glp}-IETNKKCQGGSCASVCRKVIGVAAGKCINGRCVCYP (Disulfide bonds:Cys8-Cys28, Cys13-Cys33 and Cys17-Cys35) |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Solubility Information | H2O: 1 mg/mL (0.26 mM), Sonication is recommended. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.