Shopping Cart

Remove All
Your shopping cart is currently empty

Proceed to checkout Continue shopping

Albiglutide Fragment

Name: Albiglutide Fragment
Brand: TargetMol
SKU: TQ0004
Rating: 4.5 (1 reviews)

😃Good

Catalog No. TQ0004Cas No. 782500-75-8

Albiglutide fragment is a 30-amino-acid sequence of modified human GLP-1 (fragment 7-36).

Albiglutide Fragment

😃Good

Catalog No. TQ0004Cas No. 782500-75-8

Albiglutide fragment is a 30-amino-acid sequence of modified human GLP-1 (fragment 7-36).

Pack Size	Price	Availability
5 mg	$297	Backorder
10 mg	$434	Backorder
25 mg	$879	Backorder

Add to Cart

Add to Quotation

Bulk & Custom

All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Questions

Resource Download

Product Introduction

Bioactivity

Description

Albiglutide fragment is a 30-amino-acid sequence of modified human GLP-1 (fragment 7-36).

Chemical Properties

Molecular Weight	3283.6
Formula	C₁₄₈H₂₂₄N₄₀O₄₅
Cas No.	782500-75-8
Relative Density.	no data available
Sequence	His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2
Sequence Short	HGEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2

Storage & Solubility Information

Storage

keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature.

Solubility Information

H2O: 100 mg/mL (30.45 mM), Sonication is recommended.

Solution Preparation Table

H2O

	1mg	5mg	10mg	50mg
1 mM	0.3045 mL	1.5227 mL	3.0454 mL	15.2272 mL
5 mM	0.0609 mL	0.3045 mL	0.6091 mL	3.0454 mL
10 mM	0.0305 mL	0.1523 mL	0.3045 mL	1.5227 mL
20 mM	0.0152 mL	0.0761 mL	0.1523 mL	0.7614 mL

Calculator

Molarity Calculator
Dilution Calculator
Reconstitution Calculator
Molecular Weight Calculator

In Vivo Formulation Calculator (Clear solution)

Please enter your animal experiment information in the following box and click Calculate to obtain the mother liquor preparation method and in vivo formula preparation method:

For example, your dosage is 10 mg/kg Each animal weighs 20 g, and the dosage volume is 100 μL . TargetMol | Animal experiments

A total of 10 animals were administered, and the formula you used is 5% TargetMol | reagent

DMSO+30% PEG300+5% Tween 80+60% Saline/PBS/ddH₂O. So your working solution concentration is 2 mg/mL。

Mother liquor preparation method: 2 mg of drug dissolved in 50 μL DMSO TargetMol | reagent

(mother liquor concentration of 40 mg/mL), if you need to configure a concentration that exceeds the solubility of the product, please contact us first.

Preparation method for in vivo formula: Take 50 μL DMSO TargetMol | reagent

main solution, add 300 μLPEG300 TargetMol | reagent

mix well and clarify, then add 50 more μL Tween 80, mix well and clarify, then add 600 more μLSaline/PBS/ddH₂O TargetMol | reagent

mix well and clarify

For Reference Only. Please develop an appropriate dissolution method based on your laboratory animals and route of administration.

All types of co-solvents required for the protocol, such asDMSO, PEG300/ PEG400, Tween 80, SBE-β-CD, corn oil are available for purchase on the TargetMol website with a simple click.

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Sci Citations

Tech Support

Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc