Shopping Cart
- Remove All
- Your shopping cart is currently empty
Albiglutide fragment is a 30-amino-acid sequence of modified human GLP-1 (fragment 7-36).
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | $297 | Backorder | |
10 mg | $434 | Backorder | |
25 mg | $879 | Backorder |
Description | Albiglutide fragment is a 30-amino-acid sequence of modified human GLP-1 (fragment 7-36). |
Molecular Weight | 3283.6 |
Formula | C148H224N40O45 |
Cas No. | 782500-75-8 |
Relative Density. | no data available |
Sequence | His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2 |
Sequence Short | HGEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. | |||||||||||||||||||||||||
Solubility Information | H2O: 100 mg/mL (30.45 mM), Sonication is recommended. | |||||||||||||||||||||||||
Solution Preparation Table | ||||||||||||||||||||||||||
H2O
|
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.