Shopping Cart
Remove All
Your shopping cart is currently empty
Albiglutide fragment is a 30-amino-acid sequence of modified human GLP-1 (fragment 7-36).
| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 5 mg | $297 | Inquiry | Inquiry | |
| 10 mg | $434 | Inquiry | Inquiry | |
| 25 mg | $879 | Inquiry | Inquiry |
| Description | Albiglutide fragment is a 30-amino-acid sequence of modified human GLP-1 (fragment 7-36). |
| Molecular Weight | 3283.6 |
| Formula | C148H224N40O45 |
| Cas No. | 782500-75-8 |
| Relative Density. | no data available |
| Sequence | His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2 |
| Sequence Short | HGEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. | |||||||||||||||||||||||||
| Solubility Information | H2O: 100 mg/mL (30.45 mM), Sonication is recommended. | |||||||||||||||||||||||||
Solution Preparation Table | ||||||||||||||||||||||||||
H2O
| ||||||||||||||||||||||||||
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.