Shopping Cart
- Remove All
- Your shopping cart is currently empty
Agouti-related Protein (AGRP) (83-132) Amide (human) is a segment derived from the agouti-related protein (AGRP), abundantly present in the hypothalamus' arcuate nucleus, and functions predominantly as an inverse agonist for the melanocortin-4 receptor (MC4R), thereby promoting food intake [1] [2].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | Agouti-related Protein (AGRP) (83-132) Amide (human) is a segment derived from the agouti-related protein (AGRP), abundantly present in the hypothalamus' arcuate nucleus, and functions predominantly as an inverse agonist for the melanocortin-4 receptor (MC4R), thereby promoting food intake [1] [2]. |
Molecular Weight | 5676.6 |
Formula | C235H362N76O67S11 |
Sequence | Ser-Ser-Arg-Arg-Cys-Val-Arg-Leu-His-Glu-Ser-Cys-Leu-Gly-Gln-Gln-Val-Pro-Cys-Cys-Asp-Pro-Cys-Ala-Thr-Cys-Tyr-Cys-Arg-Phe-Phe-Asn-Ala-Phe-Cys-Tyr-Cys-Arg-Lys-Leu-Gly-Thr-Ala-Met-Asn-Pro-Cys-Ser-Arg-Thr-NH2 (Disulfide bridge: Cys1-Cys4; Cys2-Cys6; Cys3-Cys9; |
Sequence Short | SSRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTAMNPCSRT-NH2 (Disulfide bridge: Cys1-Cys4; Cys2-Cys6; Cys3-Cys9; Cys5-Cys10; Cys7-Cys8) |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.