Shopping Cart
- Remove All
- Your shopping cart is currently empty
Adrenocorticotropic hormone TFA is an adrenocorticotropic hormone secreted by the anterior pituitary gland and is involved in the neurohormonal regulation of the body.Adrenocorticotropic hormone TFA is often used as a health indicator in blood tests.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
1 mg | $53 | In Stock | |
5 mg | $133 | In Stock | |
10 mg | $216 | In Stock | |
25 mg | $457 | In Stock | |
50 mg | $695 | In Stock | |
100 mg | $998 | In Stock |
Description | Adrenocorticotropic hormone TFA is an adrenocorticotropic hormone secreted by the anterior pituitary gland and is involved in the neurohormonal regulation of the body.Adrenocorticotropic hormone TFA is often used as a health indicator in blood tests. |
Synonyms | Adrenocorticotropic hormone TFA(9002-60-2 free base), Adrenocorticotrophic hormone TFA, ACTH TFA |
Color | White |
Appearance | Solid |
Sequence | Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe |
Sequence Short | SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF |
Storage | keep away from moisture,store at low temperature | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Solubility Information | H2O: 40 mg/mL, Sonication is recommended. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.