Your shopping cart is currently empty

Synonyms: Adrenocorticotropic hormone TFA(9002-60-2 free base), Adrenocorticotrophic hormone TFA, ACTH TFA

| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 1 mg | $53 | In Stock | In Stock | |
| 5 mg | $133 | In Stock | In Stock | |
| 10 mg | $216 | In Stock | In Stock | |
| 25 mg | $457 | In Stock | In Stock | |
| 50 mg | $695 | In Stock | In Stock | |
| 100 mg | $998 | - | In Stock |
| Description | Adrenocorticotropic hormone TFA is an adrenocorticotropic hormone secreted by the anterior pituitary gland and is involved in the neurohormonal regulation of the body.Adrenocorticotropic hormone TFA is often used as a health indicator in blood tests. |
| Synonyms | Adrenocorticotropic hormone TFA(9002-60-2 free base), Adrenocorticotrophic hormone TFA, ACTH TFA |
| Sequence | Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe |
| Sequence Short | SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF |
| Storage | Keep away from moisture,Store at low temperature Powder: -20°C for 3 years | In solvent: -80°C for 1 year Shipping with blue ice/Shipping at ambient temperature. |
| Solubility Information | H2O: 40 mg/mL, Sonication is recommended. |
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 µL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 µL Tween 80 and mix well until fully clarified.
3) Add 450 µL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.