Shopping Cart
- Remove All
- Your shopping cart is currently empty
Aah II, a sodium channel modulator, is a toxin derived from the venom of the scorpion Androctonus australis [1] [2].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | Aah II, a sodium channel modulator, is a toxin derived from the venom of the scorpion Androctonus australis [1] [2]. |
Molecular Weight | 7243.04 |
Formula | C313H457N89O95S8 |
Sequence | Val-Lys-Asp-Gly-Tyr-Ile-Val-Asp-Asp-Val-Asn-Cys-Thr-Tyr-Phe-Cys-Gly-Arg-Asn-Ala-Tyr-Cys-Asn-Glu-Glu-Cys-Thr-Lys-Leu-Lys-Gly-Glu-Ser-Gly-Tyr-Cys-Gln-Trp-Ala-Ser-Pro-Tyr-Gly-Asn-Ala-Cys-Tyr-Cys-Tyr-Lys-Leu-Pro-Asp-His-Val-Arg-Thr-Lys-Gly-Pro-Gly-Arg-Cys-His |
Sequence Short | VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH-NH2 (Disulfide bridge:Cys12-Cys63, Cys16-Cys36, Cys22-Cys46, Cys26-Cys48) |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.