Your shopping cart is currently empty

[Tyr^0] Corticotropin Releasing Factor, ovine, is a hypothalamic hormone sourced from sheep that prompts the secretion of adrenocorticotropic hormone (ACTH) and β-endorphin [1] [2].
| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 mg | Inquiry | Inquiry | Inquiry | |
| 50 mg | Inquiry | Inquiry | Inquiry |
| Description | [Tyr^0] Corticotropin Releasing Factor, ovine, is a hypothalamic hormone sourced from sheep that prompts the secretion of adrenocorticotropic hormone (ACTH) and β-endorphin [1] [2]. |
| In vitro | [Tyr0] Corticotropin-Releasing Factor (ovine) exhibits a high affinity for plasma protein binding [1]. |
| In vivo | [Tyr0] Corticotropin Releasing Factor, ovine, administered at 328 μCi/μg and an infusion rate of 198 pg/min or 225 pg/min via continuous intravenous infusion over 5-7 hours, demonstrates a prolonged plasma half-life and low metabolic clearance rate in male cynomolgus monkeys [1]. |
| Cas No. | 83930-34-1 |
| Sequence | H-Tyr-Ser-Gln-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Thr-Lys-Ala-Asp-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Leu-Asp-Ile-Ala-NH2 |
| Sequence Short | YSQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.