Shopping Cart
- Remove All
- Your shopping cart is currently empty
π-TRTX-Hm3a, a 37-amino acid peptide derived from the venom of the Togo starburst tarantula (Heteroscodra maculata), selectively inhibits the acid-sensing ion channel 1a (ASIC1a) in a pH-dependent manner, with an inhibitory concentration half-max (IC50) of 1-2 nM, and also potentiates the activity of acid-sensing ion channel 1b (ASIC1b) with an effective concentration half-max (EC50) of 46.5 nM [1].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | π-TRTX-Hm3a, a 37-amino acid peptide derived from the venom of the Togo starburst tarantula (Heteroscodra maculata), selectively inhibits the acid-sensing ion channel 1a (ASIC1a) in a pH-dependent manner, with an inhibitory concentration half-max (IC50) of 1-2 nM, and also potentiates the activity of acid-sensing ion channel 1b (ASIC1b) with an effective concentration half-max (EC50) of 46.5 nM [1]. |
Molecular Weight | 4287.03 |
Formula | C186H290N56O49S6 |
Sequence | Glu-Pro-Cys-Ile-Pro-Lys-Trp-Lys-Ser-Cys-Val-Asn-Arg-His-Gly-Asp-Cys-Cys-Ala-Gly-Leu-Glu-Cys-Trp-Lys-Arg-Arg-Lys-Ser-Phe-Glu-Val-Cys-Val-Pro-Lys-Val (Disulfide bridge:Cys3-Cys18;Cys10-Cys23;Cys17-Cys33) |
Sequence Short | EPCIPKWKSCVNRHGDCCAGLECWKRRKSFEVCVPKV (Disulfide bridge:Cys3-Cys18;Cys10-Cys23;Cys17-Cys33) |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.