Shopping Cart
- Remove All
- Your shopping cart is currently empty
μ-TRTX-Hd1a, a spider venom-derived compound, selectively inhibits the human NaV 1.7 channel by functioning as a gating modifier, interacting with the S3b-S4 paddle motif within domain II of the channel [1].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | μ-TRTX-Hd1a, a spider venom-derived compound, selectively inhibits the human NaV 1.7 channel by functioning as a gating modifier, interacting with the S3b-S4 paddle motif within domain II of the channel [1]. |
Molecular Weight | 3822.33 |
Formula | C160H246N46O51S6 |
Sequence | Ala-Cys-Leu-Gly-Phe-Gly-Lys-Ser-Cys-Asn-Pro-Ser-Asn-Asp-Gln-Cys-Cys-Lys-Ser-Ser-Ser-Leu-Ala-Cys-Ser-Thr-Lys-His-Lys-Trp-Cys-Lys-Tyr-Glu-Leu (Disulfide bridge:Cys2-Cys17;Cys9-Cys24;Cys16-Cys31) |
Sequence Short | ACLGFGKSCNPSNDQCCKSSSLACSTKHKWCKYEL (Disulfide bridge:Cys2-Cys17;Cys9-Cys24;Cys16-Cys31) |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.