Shopping Cart
- Remove All
- Your shopping cart is currently empty
Adrenocorticotropic Hormone (ACTH) (1-39) human (TFA), a member of the melanocortin family, is a melanocortin receptor agonist that stimulates corticosteroid production by the adrenals; melanocortin receptors are also located in the central nervous system (CNS) and on immune cells.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
1 mg | $198 | Backorder | |
5 mg | $792 | Backorder |
Description | Adrenocorticotropic Hormone (ACTH) (1-39) human (TFA), a member of the melanocortin family, is a melanocortin receptor agonist that stimulates corticosteroid production by the adrenals; melanocortin receptors are also located in the central nervous system (CNS) and on immune cells. |
Synonyms | Adrenocorticotropic Hormone (ACTH) (1-39), human(TFA) |
Molecular Weight | 4655.16 |
Formula | C207H308N56O58S.C2HF3O2 |
Relative Density. | 1.31g/cm3 |
Sequence | Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe |
Sequence Short | SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice. |
Solubility Information | H2O: Soluble |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.