Shopping Cart
- Remove All
- Your shopping cart is currently empty
Endorphin Beta is A substance produced in the brain, especially in the pituitary gland, Endorphin Beta blocks the sensation of pain. Endorphin Beta is produced in response to pain, exercise, and other forms of stress. Endorphin Beta belongs to a group of chemicals called polypeptide hormones.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
100 mg | Inquiry | Backorder | |
500 mg | Inquiry | Backorder |
Description | Endorphin Beta is A substance produced in the brain, especially in the pituitary gland, Endorphin Beta blocks the sensation of pain. Endorphin Beta is produced in response to pain, exercise, and other forms of stress. Endorphin Beta belongs to a group of chemicals called polypeptide hormones. |
Molecular Weight | 3423.94 |
Formula | C154H248N42O44S |
Cas No. | 79495-86-6 |
Relative Density. | 1.305 g/cm3 (Predicted) |
Sequence | Tyr-Gly-Gly-Phe-Met-Ser-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Ala-His-Lys-Lys-Gly-Gln |
Sequence Short | YGGFMSSEKSQTPLVTLFKNAIIKNAHKKGQ |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Solubility Information | H2O: Soluble |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.