Your shopping cart is currently empty

α-Dendrotoxin (α-DTX) is a small molecular peptide neurotoxin isolated from the venom of the African green mamba snake (Dendroaspis angusticeps). This compound acts as a blocker for KV1.1, KV1.2, KV1.6, and ASIC channels. By inhibiting potassium channels, α-Dendrotoxin reduces the threshold for neuronal action potentials and increases the frequency of these potentials, thereby enhancing neuronal excitability. It is utilized in neurotoxicological research.
| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 10 mg | Inquiry | Inquiry | Inquiry | |
| 50 mg | Inquiry | Inquiry | Inquiry |
| Description | α-Dendrotoxin (α-DTX) is a small molecular peptide neurotoxin isolated from the venom of the African green mamba snake (Dendroaspis angusticeps). This compound acts as a blocker for KV1.1, KV1.2, KV1.6, and ASIC channels. By inhibiting potassium channels, α-Dendrotoxin reduces the threshold for neuronal action potentials and increases the frequency of these potentials, thereby enhancing neuronal excitability. It is utilized in neurotoxicological research. |
| Synonyms | α-DTX |
| Molecular Weight | 7072 |
| Formula | C305H478N98O84S6 |
| Cas No. | 74504-53-3 |
| Sequence | H-Glu-Pro-Arg-Arg-Lys-Leu-Cys-Ile-Leu-His-Arg-Asn-Pro-Gly-Arg-Cys-Tyr-Asp-Lys-Ile-Pro-Ala-Phe-Tyr-Tyr-Asn-Gln-Lys-Lys-Lys-Gln-Cys-Glu-Arg-Phe-Asp-Trp-Ser-Gly-Cys-Gly-Gly-Asn-Ser-Asn-Arg-Phe-Lys-Thr-Ile-Glu-Glu-Cys-Arg-Arg-Thr-Cys-Ile-Gly-OH |
| Sequence Short | EPRRKLCILHRNPGRCYDKIPAFYYNQKKKQCERFDWSGCGGNSNRFKTIEECRRTCIG |
| Storage | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.