Popular Searches
Diphenyleneiodonium chlorideEpacadostatGilteritinibDinaciclibRo-3306
TargetMol | Star Product
Wikimole
TargetMol | New Product
New Product
TargetMol | Compound Library
Compound Library
Contact UsQuotation
Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty
TOPBioactivityChemical infoStorage&SolubilityCalculator

α-Dendrotoxin

😃Good
Catalog No. TP2759Cas No. 74504-53-3
Alias α-DTX

α-Dendrotoxin (α-DTX) is a small molecular peptide neurotoxin isolated from the venom of the African green mamba snake (Dendroaspis angusticeps). This compound acts as a blocker for KV1.1, KV1.2, KV1.6, and ASIC channels. By inhibiting potassium channels, α-Dendrotoxin reduces the threshold for neuronal action potentials and increases the frequency of these potentials, thereby enhancing neuronal excitability. It is utilized in neurotoxicological research.

α-Dendrotoxin

α-Dendrotoxin

😃Good
Catalog No. TP2759Alias α-DTXCas No. 74504-53-3
α-Dendrotoxin (α-DTX) is a small molecular peptide neurotoxin isolated from the venom of the African green mamba snake (Dendroaspis angusticeps). This compound acts as a blocker for KV1.1, KV1.2, KV1.6, and ASIC channels. By inhibiting potassium channels, α-Dendrotoxin reduces the threshold for neuronal action potentials and increases the frequency of these potentials, thereby enhancing neuronal excitability. It is utilized in neurotoxicological research.
Pack SizePriceAvailabilityQuantity
10 mgInquiryBackorder
50 mgInquiryBackorder
Bulk & Custom
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More

Resource Download

Product Introduction

Bioactivity
Description
α-Dendrotoxin (α-DTX) is a small molecular peptide neurotoxin isolated from the venom of the African green mamba snake (Dendroaspis angusticeps). This compound acts as a blocker for KV1.1, KV1.2, KV1.6, and ASIC channels. By inhibiting potassium channels, α-Dendrotoxin reduces the threshold for neuronal action potentials and increases the frequency of these potentials, thereby enhancing neuronal excitability. It is utilized in neurotoxicological research.
Aliasα-DTX
Chemical Properties
Molecular Weight7072
FormulaC305H478N98O84S6
Cas No.74504-53-3
Sequence{Pyr}-Pro-Arg-Arg-Lys-Leu-Cys-Ile-Leu-His-Arg-Asn-Pro-Gly-Arg-Cys-Tyr-Asp-Lys-Ile-Pro-Ala-Phe-Tyr-Tyr-Asn-Gln-Lys-Lys-Lys-Gln-Cys-Glu-Arg-Phe-Asp-Trp-Ser-Gly-Cys-Gly-Gly-Asn-Ser-Asn-Arg-Phe-Lys-Thr-Ile-Glu-Glu-Cys-Arg-Arg-Thr-Cys-Ile-Gly (disulfide bridge
Sequence Short{Pyr}-PRRKLCILHRNPGRCYDKIPAFYYNQKKKQCERFDWSGCGGNSNRFKTIEECRRTCIG (disulfide bridge:Cys7-Cys57,Cys16-Cys40,Cys32-Cys53)
Storage & Solubility Information
StoragePowder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature.

Calculator

  • Molarity Calculator
  • Dilution Calculator
  • Reconstitution Calculator
  • Molecular Weight Calculator

In Vivo Formulation Calculator (Clear solution)

Please enter your animal experiment information in the following box and click Calculate to obtain the mother liquor preparation method and in vivo formula preparation method:
TargetMol | Animal experimentsFor example, your dosage is 10 mg/kg Each animal weighs 20 g, and the dosage volume is 100 μL . TargetMol | Animal experiments A total of 10 animals were administered, and the formula you used is 5% TargetMol | reagent DMSO+30% PEG300+5% Tween 80+60% Saline/PBS/ddH2O. So your working solution concentration is 2 mg/mL。
Mother liquor preparation method: 2 mg of drug dissolved in 50 μL DMSOTargetMol | reagent (mother liquor concentration of 40 mg/mL), if you need to configure a concentration that exceeds the solubility of the product, please contact us first.
Preparation method for in vivo formula: Take 50 μL DMSOTargetMol | reagent main solution, add 300 μLPEG300TargetMol | reagent mix well and clarify, then add 50 more μL Tween 80, mix well and clarify, then add 600 more μLSaline/PBS/ddH2OTargetMol | reagent mix well and clarify
For Reference Only. Please develop an appropriate dissolution method based on your laboratory animals and route of administration.
1 Enter information below:
mg/kg
g
μL
2 Enter the in vivo formulation:
% DMSO
%
% Tween 80
% Saline/PBS/ddH2O

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Sci Citations

Tech Support

Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc
Related Tags: buy α-Dendrotoxin | purchase α-Dendrotoxin | α-Dendrotoxin cost | order α-Dendrotoxin | α-Dendrotoxin formula | α-Dendrotoxin molecular weight
TargetMol | Logo

Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.