Shopping Cart
- Remove All
- Your shopping cart is currently empty
(Tyr0)-Urocortin, rat, serves as a high-affinity agonist for both corticotropin-releasing factor receptor type 1 (CRF-R1) and type 2 (CRF-R2), demonstrating inhibitory binding constants (Ki) of 1-2 nM [1].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | (Tyr0)-Urocortin, rat, serves as a high-affinity agonist for both corticotropin-releasing factor receptor type 1 (CRF-R1) and type 2 (CRF-R2), demonstrating inhibitory binding constants (Ki) of 1-2 nM [1]. |
Molecular Weight | 4870.5 |
Formula | C215H347N63O66 |
Cas No. | 187111-93-9 |
Sequence Short | YDDPPLSIDLTFHLLRTLLELARTQSQRERAEQNRIIFDSV-NH2 |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.