IL-11 Protein, Rat, Recombinant (His & Myc)

Catalog No. TMPH-03317 Copy Product Info

IL-11 Protein, Rat, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 26.6 kDa and the accession number is Q99MF5.

IL-11 Protein, Rat, Recombinant (His & Myc)

Catalog No. TMPH-03317

Copy Product Info

IL-11 Protein, Rat, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 26.6 kDa and the accession number is Q99MF5.

Pack Size	Price	USA Stock	Global Stock
5 μg	$105	20 days	20 days
10 μg	$169	20 days	20 days
20 μg	$283	20 days	20 days
50 μg	$428	20 days	20 days
100 μg	$590	20 days	20 days
200 μg	$913	20 days	20 days
500 μg	$1,620	20 days	20 days
1 mg	$2,530	20 days	20 days

Add to Cart

Add to Quotation

For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Resource Download

User Guide of Recombinant Proteins

Product Information

Biological Activity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	IL-11 Protein, Rat, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 26.6 kDa and the accession number is Q99MF5.
Species	Rat
Expression System	E. coli
Tag	N-10xHis, C-Myc
Accession Number	Q99MF5
Synonyms	Interleukin-11,IL-11,Il11
Amino Acid	PGPPAGSPRVSSDPRADLDSAVLLTRSLLADTRQLAAQMRDKFPADGDHNLDSLPTLAMSAGTLGSLQLPGVLTRLRVDLMSYFRHVQWLRRAAGPSLKTLEPELGALQARLERLLRRLQLLMSRLALPQAAPDQPAVPLGPPASAWGSIRAAHAILGGLHLTLDWAVRGLLLLKTRL
Construction	22-199 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Molecular Weight	26.6 kDa (predicted)
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background	Cytokine that stimulates the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells and induces megakaryocyte maturation resulting in increased platelet production. Also promotes the proliferation of hepatocytes in response to liver damage. Binding to its receptor formed by IL6ST and IL11RA activates a signaling cascade that promotes cell proliferation. Signaling leads to the activation of intracellular protein kinases and the phosphorylation of STAT3. The interaction with the membrane-bound IL11RA and IL6ST stimulates 'classic signaling', whereas the binding of IL11 and soluble IL11RA to IL6ST stimulates 'trans-signaling'.