Shopping Cart
Remove All
Your shopping cart is currently empty
IL-11 Protein, Rat, Recombinant (His & PDI) is expressed in yeast with N-6xHis-PDI tag. The predicted molecular weight is 78.0 kDa and the accession number is Q99MF5.

| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 μg | $123 | 20 days | 20 days | |
| 10 μg | $198 | 20 days | 20 days | |
| 20 μg | $339 | 20 days | 20 days | |
| 50 μg | $497 | 20 days | 20 days | |
| 100 μg | $696 | 20 days | 20 days | |
| 200 μg | $1,070 | 20 days | 20 days | |
| 500 μg | $1,890 | 20 days | 20 days | |
| 1 mg | $2,970 | 20 days | 20 days |
| Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | IL-11 Protein, Rat, Recombinant (His & PDI) is expressed in yeast with N-6xHis-PDI tag. The predicted molecular weight is 78.0 kDa and the accession number is Q99MF5. |
| Species | Rat |
| Expression System | P. pastoris (Yeast) |
| Tag | N-6xHis-PDI |
| Accession Number | Q99MF5 |
| Synonyms | Interleukin-11,IL-11,Il11 |
| Amino Acid | PGPPAGSPRVSSDPRADLDSAVLLTRSLLADTRQLAAQMRDKFPADGDHNLDSLPTLAMSAGTLGSLQLPGVLTRLRVDLMSYFRHVQWLRRAAGPSLKTLEPELGALQARLERLLRRLQLLMSRLALPQAAPDQPAVPLGPPASAWGSIRAAHAILGGLHLTLDWAVRGLLLLKTRL |
| Construction | 22-199 aa |
| Protein Purity | > 85% as determined by SDS-PAGE. |
| Molecular Weight | 78.0 kDa (predicted) |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Research Background | Cytokine that stimulates the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells and induces megakaryocyte maturation resulting in increased platelet production. Also promotes the proliferation of hepatocytes in response to liver damage. Binding to its receptor formed by IL6ST and IL11RA activates a signaling cascade that promotes cell proliferation. Signaling leads to the activation of intracellular protein kinases and the phosphorylation of STAT3. The interaction with the membrane-bound IL11RA and IL6ST stimulates 'classic signaling', whereas the binding of IL11 and soluble IL11RA to IL6ST stimulates 'trans-signaling'. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.