Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

IL-11 Protein, Rat, Recombinant (His & PDI)

Copy Product Info
TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-03318

IL-11 Protein, Rat, Recombinant (His & PDI) is expressed in yeast with N-6xHis-PDI tag. The predicted molecular weight is 78.0 kDa and the accession number is Q99MF5.

IL-11 Protein, Rat, Recombinant (His & PDI)

IL-11 Protein, Rat, Recombinant (His & PDI)

Copy Product Info
TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-03318
IL-11 Protein, Rat, Recombinant (His & PDI) is expressed in yeast with N-6xHis-PDI tag. The predicted molecular weight is 78.0 kDa and the accession number is Q99MF5.
Pack SizePriceUSA WarehouseGlobal WarehouseQuantity
5 μg$12320 days20 days
10 μg$19820 days20 days
20 μg$33920 days20 days
50 μg$49720 days20 days
100 μg$69620 days20 days
200 μg$1,07020 days20 days
500 μg$1,89020 days20 days
1 mg$2,97020 days20 days
Add to Cart
Add to Quotation
In Stock Estimated shipping dateUSA Warehouse [1-2 days] Global Warehouse [5-7 days]
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
IL-11 Protein, Rat, Recombinant (His & PDI) is expressed in yeast with N-6xHis-PDI tag. The predicted molecular weight is 78.0 kDa and the accession number is Q99MF5.
Species
Rat
Expression System
P. pastoris (Yeast)
TagN-6xHis-PDI
Accession NumberQ99MF5
Synonyms
Interleukin-11,IL-11,Il11
Amino Acid
PGPPAGSPRVSSDPRADLDSAVLLTRSLLADTRQLAAQMRDKFPADGDHNLDSLPTLAMSAGTLGSLQLPGVLTRLRVDLMSYFRHVQWLRRAAGPSLKTLEPELGALQARLERLLRRLQLLMSRLALPQAAPDQPAVPLGPPASAWGSIRAAHAILGGLHLTLDWAVRGLLLLKTRL
Construction
22-199 aa
Protein Purity
> 85% as determined by SDS-PAGE.
Molecular Weight78.0 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationIf the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background
Cytokine that stimulates the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells and induces megakaryocyte maturation resulting in increased platelet production. Also promotes the proliferation of hepatocytes in response to liver damage. Binding to its receptor formed by IL6ST and IL11RA activates a signaling cascade that promotes cell proliferation. Signaling leads to the activation of intracellular protein kinases and the phosphorylation of STAT3. The interaction with the membrane-bound IL11RA and IL6ST stimulates 'classic signaling', whereas the binding of IL11 and soluble IL11RA to IL6ST stimulates 'trans-signaling'.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords