Shopping Cart
- Remove All
- Your shopping cart is currently empty
Wasabi Receptor Toxin TFA (WaTx TFA) is the TFA salt form of Wasabi Receptor Toxin. This compound functions as a cell-permeable scorpion toxin and serves as an activator of the TRPA1 ion channel (TRPA1 ion channel), exhibiting its potency with an EC50 at the nanomolar level. It effectively prolongs the channel opening time while reducing Ca2+ permeability. Additionally, WaTx TFA induces thermal hyperalgesia and mechanical allodynia in rats without causing neurogenic inflammation.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
10 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | Wasabi Receptor Toxin TFA (WaTx TFA) is the TFA salt form of Wasabi Receptor Toxin. This compound functions as a cell-permeable scorpion toxin and serves as an activator of the TRPA1 ion channel (TRPA1 ion channel), exhibiting its potency with an EC50 at the nanomolar level. It effectively prolongs the channel opening time while reducing Ca2+ permeability. Additionally, WaTx TFA induces thermal hyperalgesia and mechanical allodynia in rats without causing neurogenic inflammation. |
Synonyms | WaTx TFA |
Sequence | Ala-Ser-Pro-Gln-Gln-Ala-Lys-Tyr-Cys-Tyr-Glu-Gln-Cys-Asn-Val-Asn-Lys-Val-Pro-Phe-Asp-Gln-Cys-Tyr-Gln-Met-Cys-Ser-Pro-Leu-Glu-Arg-Ser (Disulfide bridge: Cys9-Cys27; Cys13-Cys23) |
Sequence Short | ASPQQAKYCYEQCNVNKVPFDQCYQMCSPLERS (Disulfide bridge: Cys9-Cys27; Cys13-Cys23) |
Storage | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.