Your shopping cart is currently empty

Wasabi Receptor Toxin TFA (WaTx TFA) is the TFA salt form of Wasabi Receptor Toxin. This compound functions as a cell-permeable scorpion toxin and serves as an activator of the TRPA1 ion channel (TRPA1 ion channel), exhibiting its potency with an EC50 at the nanomolar level. It effectively prolongs the channel opening time while reducing Ca2+ permeability. Additionally, WaTx TFA induces thermal hyperalgesia and mechanical allodynia in rats without causing neurogenic inflammation.
| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 10 mg | Inquiry | Inquiry | Inquiry | |
| 50 mg | Inquiry | Inquiry | Inquiry |
| Description | Wasabi Receptor Toxin TFA (WaTx TFA) is the TFA salt form of Wasabi Receptor Toxin. This compound functions as a cell-permeable scorpion toxin and serves as an activator of the TRPA1 ion channel (TRPA1 ion channel), exhibiting its potency with an EC50 at the nanomolar level. It effectively prolongs the channel opening time while reducing Ca2+ permeability. Additionally, WaTx TFA induces thermal hyperalgesia and mechanical allodynia in rats without causing neurogenic inflammation. |
| Synonyms | WaTx TFA |
| Sequence | Ala-Ser-Pro-Gln-Gln-Ala-Lys-Tyr-Cys-Tyr-Glu-Gln-Cys-Asn-Val-Asn-Lys-Val-Pro-Phe-Asp-Gln-Cys-Tyr-Gln-Met-Cys-Ser-Pro-Leu-Glu-Arg-Ser (Disulfide bridge: Cys9-Cys27; Cys13-Cys23) |
| Sequence Short | ASPQQAKYCYEQCNVNKVPFDQCYQMCSPLERS (Disulfide bridge: Cys9-Cys27; Cys13-Cys23) |
| Storage | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.