Shopping Cart
- Remove All
- Your shopping cart is currently empty
Wasabi Receptor Toxin (WaTx) activates TRPA1 through prolonged channel openings while reducing Ca2+ permeability. This compound has potential applications in studying both acute and persistent pain [1].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | Wasabi Receptor Toxin (WaTx) activates TRPA1 through prolonged channel openings while reducing Ca2+ permeability. This compound has potential applications in studying both acute and persistent pain [1]. |
Alias | WaTx |
Cas No. | 2569291-86-5 |
Sequence | Ala-Ser-Pro-Gln-Gln-Ala-Lys-Tyr-Cys-Tyr-Glu-Gln-Cys-Asn-Val-Asn-Lys-Val-Pro-Phe-Asp-Gln-Cys-Tyr-Gln-Met-Cys-Ser-Pro-Leu-Glu-Arg-Ser (Disulfide bridge: Cys9-Cys27; Cys13-Cys23) |
Sequence Short | ASPQQAKYCYEQCNVNKVPFDQCYQMCSPLERS (Disulfide bridge: Cys9-Cys27; Cys13-Cys23) |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.