Your shopping cart is currently empty

Tat-ASIC1a (1-20) (mouse, rat) is a competitive ASIC1a transmembrane peptide with significant neuroprotective effects. It alleviates acidotoxic neuronal damage by targeting the ASIC1a-RIPK1 pathway and an auto-inhibition mechanism. This compound effectively safeguards the brain in ischemic stroke mouse models against damage from ischemia and is applicable in research on neurodegenerative diseases, such as Huntington's disease and Parkinson’s disease.
| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 10 mg | Inquiry | Inquiry | Inquiry | |
| 50 mg | Inquiry | Inquiry | Inquiry |
| Description | Tat-ASIC1a (1-20) (mouse, rat) is a competitive ASIC1a transmembrane peptide with significant neuroprotective effects. It alleviates acidotoxic neuronal damage by targeting the ASIC1a-RIPK1 pathway and an auto-inhibition mechanism. This compound effectively safeguards the brain in ischemic stroke mouse models against damage from ischemia and is applicable in research on neurodegenerative diseases, such as Huntington's disease and Parkinson’s disease. |
| Sequence | Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Cys-Met-Glu-Leu-Lys-Thr-Glu-Glu-Glu-Glu-Val-Gly-Gly-Val-Gln-Pro-Val-Ser-Ile-Gln-Ala |
| Sequence Short | GRKKRRQRRRCMELKTEEEEVGGVQPVSIQA |
| Storage | Powder: -20°C for 3 years | In solvent: -80°C for 1 year Shipping with blue ice/Shipping at ambient temperature. |
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.