Shopping Cart
- Remove All
- Your shopping cart is currently empty
Super-TDU (1-31), a peptide fragment of Super-TDU, acts as an inhibitor of the YAP-TEAD complex. Demonstrating potent anti-tumor activity, it effectively suppresses tumor growth in a gastric cancer mouse model [1] [2].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | Super-TDU (1-31), a peptide fragment of Super-TDU, acts as an inhibitor of the YAP-TEAD complex. Demonstrating potent anti-tumor activity, it effectively suppresses tumor growth in a gastric cancer mouse model [1] [2]. |
Molecular Weight | 3241.48 |
Formula | C141H218N40O48 |
Sequence | Ser-Val-Asp-Asp-His-Phe-Ala-Lys-Ser-Leu-Gly-Asp-Thr-Trp-Leu-Gln-Ile-Gly-Gly-Ser-Gly-Asn-Pro-Lys-Thr-Ala-Asn-Val-Pro-Gln-Thr |
Sequence Short | SVDDHFAKSLGDTWLQIGGSGNPKTANVPQT |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.