Shopping Cart
Remove All
Your shopping cart is currently empty
Synonyms:

| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 10 mg | Inquiry | Inquiry | Inquiry | |
| 50 mg | Inquiry | Inquiry | Inquiry |
| Description | Sublancin is an antimicrobial peptide that inhibits DNA replication, transcription, and translation without affecting membrane integrity, and suppresses glucose uptake through competition with the phosphotransferase system (PTS). Sublancin inhibits B. subtilis strain 168 ΔSPβ with a MIC of 0.312 μM [1][2]. |
| In vitro | Sublancin (0-500 μM, 24 h) effectively inhibits methicillin-resistant Staphylococcus aureus (MRSA) with a minimum inhibitory concentration (MIC) of 15 μM, and demonstrates no cytotoxicity in RAW246.7 macrophages, mouse peritoneal macrophages, and human Caco-2 epithelial cells [1]. Cell Viability Assay [1] Cell Line: RAW246.7, Caco-2, P-Mac Concentration: 0-500 μM Incubation Time: 24 h Result: Maintained cell viability. |
| In vivo | Sublancin (0.5-4 mg/kg, administered intraperitoneally as a single dose) enhances the condition of mice infected with MRSA by inducing IL-6 and MCP-1, while mitigating intestinal inflammation through the inhibition of NF-κB activation [1]. Animal Model: Methicillin-resistant Staphylococcus aureus infected mice [1] Dosage: 0.5-4 mg/kg Administration: ip, single dose Result: Improved survival rate, reduced body weight loss. |
| Molecular Weight | 3878.38 |
| Formula | C162H254N50O51S5 |
| Cas No. | 207410-26-2 |
| Smiles | no |
| Sequence | Gly-Leu-Gly-Lys-Ala-Gln-Cys-Ala-Ala-Leu-Trp-Leu-Gln-Cys-Ala-Ser-Gly-Gly-Thr-Ile-Gly-{Cys(D-glucopyranosyl)}-Gly-Gly-Gly-Ala-Val-Ala-Cys-Gln-Asn-Tyr-Arg-Gln-Phe-Cys-Arg (Disulfide bridge:Cys7-Cys36;Cys14-Cys29) |
| Sequence Short | GLGKAQCAALWLQCASGGTIGCGGGAVACQNYRQFCR |
| Storage | Powder: -20°C for 3 years | In solvent: -80°C for 1 year Shipping with blue ice/Shipping at ambient temperature. |
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.