Shopping Cart
- Remove All
- Your shopping cart is currently empty
Slotoxin, a peptide extracted from the venom of the Centruroides noxius Hoffmann scorpion, inhibits high-conductance calcium-activated potassium channels with a dissociation constant (Kd) of 1.5 nM [1].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | Slotoxin, a peptide extracted from the venom of the Centruroides noxius Hoffmann scorpion, inhibits high-conductance calcium-activated potassium channels with a dissociation constant (Kd) of 1.5 nM [1]. |
Molecular Weight | 4085.82 |
Formula | C177H275N47O50S7 |
Sequence | Thr-Phe-Ile-Asp-Val-Asp-Cys-Thr-Val-Ser-Lys-Glu-Cys-Trp-Ala-Pro-Cys-Lys-Ala-Ala-Phe-Gly-Val-Asp-Arg-Gly-Lys-Cys-Met-Gly-Lys-Lys-Cys-Lys-Cys-Tyr-Val (Disulfide bridge: Cys7-Cys28; Cys13-Cys33; Cys17-Cys35) |
Sequence Short | TFIDVDCTVSKECWAPCKAAFGVDRGKCMGKKCKCYV (Disulfide bridge: Cys7-Cys28; Cys13-Cys33; Cys17-Cys35) |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.