Shopping Cart
Remove All
Your shopping cart is currently empty
PNC-27, an anticancer peptide with an HDM-2-binding domain, exhibits antitumor activity and has potential applications in acute myeloid leukemia research [1] [2] [3].
| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 5 mg | Inquiry | Inquiry | Inquiry | |
| 50 mg | Inquiry | Inquiry | Inquiry |
| Description | PNC-27, an anticancer peptide with an HDM-2-binding domain, exhibits antitumor activity and has potential applications in acute myeloid leukemia research [1] [2] [3]. |
| In vitro | PNC-27, at a concentration of 50 μg/mL applied for a duration of 0-3 hours, induces cancer cell death [1]. |
| In vivo | PNC-27, administered via intraperitoneal injection at a dose of 40 mg/kg daily for 2-3 weeks, exhibits anti-leukemic activity in vivo [2]. |
| Cas No. | 1159861-00-3 |
| Sequence Short | PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.