Shopping Cart
- Remove All
- Your shopping cart is currently empty
Pezadeftide, a potent antifungal peptide, readily penetrates fungal cells, eliciting an immediate mitochondrial response that leads to hyperpolarization of the mitochondrial membrane [1].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | Pezadeftide, a potent antifungal peptide, readily penetrates fungal cells, eliciting an immediate mitochondrial response that leads to hyperpolarization of the mitochondrial membrane [1]. |
Cas No. | 1907724-92-8 |
Sequence | Ala-Lys-Val-Cys-Thr-Lys-Pro-Ser-Lys-Phe-Phe-Lys-Gly-Leu-Cys-Gly-Thr-Asp-Gly-Ala-Cys-Thr-Thr-Ala-Cys-Arg-Lys-Glu-Gly-Leu-His-Ser-Gly-Tyr-Cys-Gln-Leu-Lys-Gly-Phe-Leu-Asn-Ser-Val-Cys-Val-Cys-Arg-Lys-His-Cys |
Sequence Short | AKVCTKPSKFFKGLCGTDGACTTACRKEGLHSGYCQLKGFLNSVCVCRKHC |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.