Shopping Cart
Remove All
Your shopping cart is currently empty
Oxyntomodulin (bovine, porcine) TFA is a 37-amino acid peptide hormone that functions as a glucagon-like peptide 1 (GLP-1) receptor agonist [1].
| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 5 mg | Inquiry | Inquiry | Inquiry | |
| 50 mg | Inquiry | Inquiry | Inquiry |
| Description | Oxyntomodulin (bovine, porcine) TFA is a 37-amino acid peptide hormone that functions as a glucagon-like peptide 1 (GLP-1) receptor agonist [1]. |
| In vitro | Oxyntomodulin (bovine, porcine), a gut-derived postprandial peptide hormone, simultaneously targets and activates the glucagon-like peptide-1 receptor (GLP1R) and the glucagon receptor (GCGR). This dual activation leads to more pronounced body weight reduction than that observed with selective GLP1R agonists alone. Produced primarily in the L-cells of the gut, oxyntomodulin is generated through the enzymatic processing of the preproglucagon precursor by prohormone convertase 1/3. As a full agonist on human GLP1R and GCGR in overexpressing cell lines, oxyntomodulin facilitates cAMP accumulation, albeit with lower affinity compared to GLP-1 and glucagon [1]. |
| Synonyms | Glucagon-37 (bovine, porcine) (TFA) |
| Formula | C192H295N59O60S.xC2HF3O2 |
| Sequence Short | HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.