Your shopping cart is currently empty

Oxyntomodulin (bovine, porcine) TFA is a 37-amino acid peptide hormone that functions as a glucagon-like peptide 1 (GLP-1) receptor agonist [1].
| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 5 mg | Inquiry | Inquiry | Inquiry | |
| 50 mg | Inquiry | Inquiry | Inquiry |
| Description | Oxyntomodulin (bovine, porcine) TFA is a 37-amino acid peptide hormone that functions as a glucagon-like peptide 1 (GLP-1) receptor agonist [1]. |
| In vitro | Oxyntomodulin (bovine, porcine), a gut-derived postprandial peptide hormone, simultaneously targets and activates the glucagon-like peptide-1 receptor (GLP1R) and the glucagon receptor (GCGR). This dual activation leads to more pronounced body weight reduction than that observed with selective GLP1R agonists alone. Produced primarily in the L-cells of the gut, oxyntomodulin is generated through the enzymatic processing of the preproglucagon precursor by prohormone convertase 1/3. As a full agonist on human GLP1R and GCGR in overexpressing cell lines, oxyntomodulin facilitates cAMP accumulation, albeit with lower affinity compared to GLP-1 and glucagon [1]. |
| Synonyms | Glucagon-37 (bovine, porcine) (TFA) |
| Formula | C192H295N59O60S.xC2HF3O2 |
| Sequence | His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr-Lys-Arg-Asn-Lys-Asn-Asn-Ile-Ala |
| Sequence Short | HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.