Shopping Cart
- Remove All
- Your shopping cart is currently empty
Neuropeptide W-30 (rat) acts as a crucial stress mediator within the central nervous system, influencing the hypothalamus-pituitary-adrenal (HPA) axis and sympathetic outflow. It serves as an endogenous ligand for the two related orphan G-protein-coupled receptors (GPCRs), GPR7 and GPR8. NPW-30 binds and activates both GPR7 and GPR8 at comparable effective doses [1] [2] [3].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
10 mg | Inquiry | Inquiry | |
50 mg | Inquiry | Inquiry |
Description | Neuropeptide W-30 (rat) acts as a crucial stress mediator within the central nervous system, influencing the hypothalamus-pituitary-adrenal (HPA) axis and sympathetic outflow. It serves as an endogenous ligand for the two related orphan G-protein-coupled receptors (GPCRs), GPR7 and GPR8. NPW-30 binds and activates both GPR7 and GPR8 at comparable effective doses [1] [2] [3]. |
In vitro | Neuropeptide W-30 (i.c.v.) alters the secretion of anterior pituitary hormones, such as prolactin and growth hormone, and affects behaviors like feeding and drinking. |
Synonyms | NPW30, rat |
Molecular Weight | 3559.11 |
Formula | C165H249N49O38S |
Cas No. | 383415-90-5 |
Sequence | Trp-Tyr-Lys-His-Val-Ala-Ser-Pro-Arg-Tyr-His-Thr-Val-Gly-Arg-Ala-Ser-Gly-Leu-Leu-Met-Gly-Leu-Arg-Arg-Ser-Pro-Tyr-Leu-Trp |
Sequence Short | WYKHVASPRYHTVGRASGLLMGLRRSPYLW |
Storage | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.