Your shopping cart is currently empty

Neuropeptide W-30 (rat) acts as a crucial stress mediator within the central nervous system, influencing the hypothalamus-pituitary-adrenal (HPA) axis and sympathetic outflow. It serves as an endogenous ligand for the two related orphan G-protein-coupled receptors (GPCRs), GPR7 and GPR8. NPW-30 binds and activates both GPR7 and GPR8 at comparable effective doses [1] [2] [3].

| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 10 mg | Inquiry | Inquiry | Inquiry | |
| 50 mg | Inquiry | Inquiry | Inquiry |
| Description | Neuropeptide W-30 (rat) acts as a crucial stress mediator within the central nervous system, influencing the hypothalamus-pituitary-adrenal (HPA) axis and sympathetic outflow. It serves as an endogenous ligand for the two related orphan G-protein-coupled receptors (GPCRs), GPR7 and GPR8. NPW-30 binds and activates both GPR7 and GPR8 at comparable effective doses [1] [2] [3]. |
| In vitro | Neuropeptide W-30 (i.c.v.) alters the secretion of anterior pituitary hormones, such as prolactin and growth hormone, and affects behaviors like feeding and drinking. |
| Synonyms | NPW30, rat |
| Molecular Weight | 3559.11 |
| Formula | C165H249N49O38S |
| Cas No. | 383415-90-5 |
| Smiles | C([C@H](NC([C@@H](NC([C@@H](NC(=O)[C@H]1N(C([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC(CNC([C@@H](NC([C@@H](NC([C@@H](NC(CNC([C@@H](NC([C@@H](NC([C@@H](NC(CNC([C@@H](NC([C@@H](NC([C@H](CC2=CN=CN2)NC([C@H](CC3=CC=C(O)C=C3)NC([C@@H](NC(=O)[C@H]4N(C([C@@H](NC([C@@H](NC([C@@H](NC([C@H](CC5=CN=CN5)NC([C@@H](NC([C@H](CC6=CC=C(O)C=C6)NC([C@H](CC=7C=8C(NC7)=CC=CC8)N)=O)=O)CCCCN)=O)=O)C(C)C)=O)C)=O)CO)=O)CCC4)CCCNC(=N)N)=O)=O)=O)[C@@H](C)O)=O)[C@H](C)C)=O)=O)CCCNC(=N)N)=O)C)=O)CO)=O)=O)CC(C)C)=O)CC(C)C)=O)CCSC)=O)=O)CC(C)C)=O)CCCNC(=N)N)=O)CCCNC(=N)N)=O)CO)=O)CCC1)CC9=CC=C(O)C=C9)=O)CC(C)C)=O)C(O)=O)C=%10C=%11C(NC%10)=CC=CC%11 |
| Sequence | Trp-Tyr-Lys-His-Val-Ala-Ser-Pro-Arg-Tyr-His-Thr-Val-Gly-Arg-Ala-Ser-Gly-Leu-Leu-Met-Gly-Leu-Arg-Arg-Ser-Pro-Tyr-Leu-Trp |
| Sequence Short | WYKHVASPRYHTVGRASGLLMGLRRSPYLW |
| Storage | Shipping with blue ice. |
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.